Home |
Help |
Advanced search
2024-04-25 02:02:14, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004965 1313 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens high mobility group nucleosome binding domain 1
(HMGN1), mRNA.
ACCESSION NM_004965 NM_001080854
VERSION NM_004965.6 GI:48255932
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1313)
AUTHORS Postnikov,Y.V., Kurahashi,T., Zhou,M. and Bustin,M.
TITLE The nucleosome binding protein HMGN1 interacts with PCNA and
facilitates its binding to chromatin
JOURNAL Mol. Cell. Biol. 32 (10), 1844-1854 (2012)
PUBMED 22393258
REMARK GeneRIF: nucleosome binding protein HMGN1 as a new PCNA-interacting
protein that enhances the binding of PCNA to chromatin
REFERENCE 2 (bases 1 to 1313)
AUTHORS Yang,D., Postnikov,Y.V., Li,Y., Tewary,P., de la Rosa,G., Wei,F.,
Klinman,D., Gioannini,T., Weiss,J.P., Furusawa,T., Bustin,M. and
Oppenheim,J.J.
TITLE High-mobility group nucleosome-binding protein 1 acts as an alarmin
and is critical for lipopolysaccharide-induced immune responses
JOURNAL J. Exp. Med. 209 (1), 157-171 (2012)
PUBMED 22184635
REMARK GeneRIF: extracellular HMGN1 acts as a novel alarmin critical for
LPS-induced development of innate and adaptive immune responses.
REFERENCE 3 (bases 1 to 1313)
AUTHORS Abuhatzira,L., Shamir,A., Schones,D.E., Schaffer,A.A. and Bustin,M.
TITLE The chromatin-binding protein HMGN1 regulates the expression of
methyl CpG-binding protein 2 (MECP2) and affects the behavior of
mice
JOURNAL J. Biol. Chem. 286 (49), 42051-42062 (2011)
PUBMED 22009741
REMARK GeneRIF: HMGN1 regulates the expression of methyl CpG-binding
protein 2 (MECP2) in mouse and human, and affects the behavior of
mice
REFERENCE 4 (bases 1 to 1313)
AUTHORS Cuddapah,S., Schones,D.E., Cui,K., Roh,T.Y., Barski,A., Wei,G.,
Rochman,M., Bustin,M. and Zhao,K.
TITLE Genomic profiling of HMGN1 reveals an association with chromatin at
regulatory regions
JOURNAL Mol. Cell. Biol. 31 (4), 700-709 (2011)
PUBMED 21173166
REMARK GeneRIF: HMGN1 is not randomly distributed throughout the genome.
Instead, the protein preferentially localizes to DNase I
hypersensitive (HS) sites, promoters, functional enhancers, and
transcription factor binding sites.
REFERENCE 5 (bases 1 to 1313)
AUTHORS Rattner,B.P., Yusufzai,T. and Kadonaga,J.T.
TITLE HMGN proteins act in opposition to ATP-dependent chromatin
remodeling factors to restrict nucleosome mobility
JOURNAL Mol. Cell 34 (5), 620-626 (2009)
PUBMED 19524541
REMARK GeneRIF: HMGN1 (HMG14) and HMGN2 (HMG17) potently repress
ATP-dependent chromatin remodeling by four different molecular
motor proteins.
REFERENCE 6 (bases 1 to 1313)
AUTHORS Postnikov,Y.V., Trieschmann,L., Rickers,A. and Bustin,M.
TITLE Homodimers of chromosomal proteins HMG-14 and HMG-17 in nucleosome
cores
JOURNAL J. Mol. Biol. 252 (4), 423-432 (1995)
PUBMED 7563062
REFERENCE 7 (bases 1 to 1313)
AUTHORS Pash,J., Popescu,N., Matocha,M., Rapoport,S. and Bustin,M.
TITLE Chromosomal protein HMG-14 gene maps to the Down syndrome region of
human chromosome 21 and is overexpressed in mouse trisomy 16
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 87 (10), 3836-3840 (1990)
PUBMED 2140193
REFERENCE 8 (bases 1 to 1313)
AUTHORS Landsman,D., McBride,O.W., Soares,N., Crippa,M.P., Srikantha,T. and
Bustin,M.
TITLE Chromosomal protein HMG-14. Identification, characterization, and
chromosome localization of a functional gene from the large human
multigene family
JOURNAL J. Biol. Chem. 264 (6), 3421-3427 (1989)
PUBMED 2563381
REFERENCE 9 (bases 1 to 1313)
AUTHORS Landsman,D., Srikantha,T., Westermann,R. and Bustin,M.
TITLE Chromosomal protein HMG-14. Complete human cDNA sequence and
evidence for a multigene family
JOURNAL J. Biol. Chem. 261 (34), 16082-16086 (1986)
PUBMED 3782107
REMARK Erratum:[J Biol Chem 1988 Nov 5;263(31):16512]
REFERENCE 10 (bases 1 to 1313)
AUTHORS Leffak,M. and Trempe,J.P.
TITLE Histone H1 and HMG 14/17 are deposited nonrandomly in the nucleus
JOURNAL Nucleic Acids Res. 13 (13), 4853-4869 (1985)
PUBMED 4022776
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BE779939.1, BC070154.1 and
AL582106.2.
On or before Mar 29, 2007 this sequence version replaced
gi:124249403, gi:47271467.
Summary: The protein encoded by this gene binds nucleosomal DNA and
is associated with transcriptionally active chromatin. Along with a
similar protein, HMG17, the encoded protein may help maintain an
open chromatin configuration around transcribable genes. [provided
by RefSeq, Aug 2011].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC000075.2, BC107741.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025081, ERS025082 [ECO:0000350]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-367 BE779939.1 60-426
368-987 BC070154.1 286-905
988-1222 AL582106.2 52-286 c
1223-1313 BC070154.1 1145-1235
FEATURES Location/Qualifiers
source 1..1313
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="21"
/map="21q22.2"
gene 1..1313
/gene="HMGN1"
/gene_synonym="HMG14"
/note="high mobility group nucleosome binding domain 1"
/db_xref="GeneID:3150"
/db_xref="HGNC:4984"
/db_xref="MIM:163920"
exon 1..219
/gene="HMGN1"
/gene_synonym="HMG14"
/inference="alignment:Splign:1.39.8"
STS 18..222
/gene="HMGN1"
/gene_synonym="HMG14"
/standard_name="ECD22897"
/db_xref="UniSTS:303882"
variation 111
/gene="HMGN1"
/gene_synonym="HMG14"
/replace="a"
/replace="g"
/db_xref="dbSNP:11541408"
CDS 205..507
/gene="HMGN1"
/gene_synonym="HMG14"
/note="high-mobility group nucleosome binding 1;
high-mobility group (nonhistone chromosomal) protein 14;
high-mobility group nucleosome binding domain 1;
nonhistone chromosomal protein HMG-14; high mobility group
nucleosome-binding domain-containing protein 1"
/codon_start=1
/product="non-histone chromosomal protein HMG-14"
/protein_id="NP_004956.5"
/db_xref="GI:48255933"
/db_xref="CCDS:CCDS33559.1"
/db_xref="GeneID:3150"
/db_xref="HGNC:4984"
/db_xref="MIM:163920"
/translation="
MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
"
misc_feature 211..213
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="acetylation site"
/db_xref="HPRD:04078"
misc_feature 223..225
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01498"
misc_feature 223..225
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:02092"
misc_feature 223..225
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03382"
misc_feature 223..225
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:04677"
misc_feature 223..225
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:06789"
misc_feature 226..228
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P05114.3); phosphorylation site"
misc_feature 244..246
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P05114.3); acetylation site"
misc_feature 244..246
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="acetylation site"
/db_xref="HPRD:04078"
misc_feature 256..258
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="acetylation site"
/db_xref="HPRD:04078"
misc_feature 265..267
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by RPS6KA5; propagated from
UniProtKB/Swiss-Prot (P05114.3); phosphorylation site"
misc_feature 265..267
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01498"
misc_feature 265..267
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:02092"
misc_feature 265..267
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03382"
misc_feature 277..279
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by RPS6KA5; propagated from
UniProtKB/Swiss-Prot (P05114.3); phosphorylation site"
misc_feature 277..279
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01498"
misc_feature 277..279
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:02092"
misc_feature 277..279
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03382"
misc_feature 283..285
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="acetylation site"
/db_xref="HPRD:04078"
misc_feature 295..297
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="acetylation site"
/db_xref="HPRD:04078"
misc_feature 316..318
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="acetylation site"
/db_xref="HPRD:04078"
misc_feature 346..348
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="acetylation site"
/db_xref="HPRD:04078"
misc_feature 361..363
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="acetylation site"
/db_xref="HPRD:04078"
misc_feature 367..369
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="acetylation site"
/db_xref="HPRD:04078"
misc_feature 385..387
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="acetylation site"
/db_xref="HPRD:04078"
misc_feature 412..414
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 448..450
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P05114.3); acetylation site"
misc_feature 448..450
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="acetylation site"
/db_xref="HPRD:04078"
misc_feature 460..462
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P05114.3); phosphorylation site"
misc_feature 460..462
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 469..471
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P05114.3); phosphorylation site"
misc_feature 469..471
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 499..501
/gene="HMGN1"
/gene_synonym="HMG14"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P05114.3); phosphorylation site"
exon 220..252
/gene="HMGN1"
/gene_synonym="HMG14"
/inference="alignment:Splign:1.39.8"
exon 253..282
/gene="HMGN1"
/gene_synonym="HMG14"
/inference="alignment:Splign:1.39.8"
exon 283..330
/gene="HMGN1"
/gene_synonym="HMG14"
/inference="alignment:Splign:1.39.8"
exon 331..459
/gene="HMGN1"
/gene_synonym="HMG14"
/inference="alignment:Splign:1.39.8"
exon 460..1304
/gene="HMGN1"
/gene_synonym="HMG14"
/inference="alignment:Splign:1.39.8"
STS 460..859
/gene="HMGN1"
/gene_synonym="HMG14"
/standard_name="ECD17402"
/db_xref="UniSTS:298415"
STS 683..1282
/gene="HMGN1"
/gene_synonym="HMG14"
/standard_name="ECD10572"
/db_xref="UniSTS:291611"
STS 770..1007
/gene="HMGN1"
/gene_synonym="HMG14"
/standard_name="REN20200"
/db_xref="UniSTS:345000"
STS 933..1282
/gene="HMGN1"
/gene_synonym="HMG14"
/standard_name="ECD18713"
/db_xref="UniSTS:299723"
variation 1005
/gene="HMGN1"
/gene_synonym="HMG14"
/replace="c"
/replace="t"
/db_xref="dbSNP:3199398"
STS 1055..1293
/gene="HMGN1"
/gene_synonym="HMG14"
/standard_name="REN20199"
/db_xref="UniSTS:344999"
variation 1067
/gene="HMGN1"
/gene_synonym="HMG14"
/replace="a"
/replace="g"
/db_xref="dbSNP:3167757"
STS 1078..1293
/gene="HMGN1"
/gene_synonym="HMG14"
/standard_name="RH80697"
/db_xref="UniSTS:87814"
STS 1110..1248
/gene="HMGN1"
/gene_synonym="HMG14"
/standard_name="G34952"
/db_xref="UniSTS:117662"
STS 1110..1248
/gene="HMGN1"
/gene_synonym="HMG14"
/standard_name="RH67009"
/db_xref="UniSTS:84442"
polyA_signal 1281..1286
/gene="HMGN1"
/gene_synonym="HMG14"
polyA_site 1304
/gene="HMGN1"
/gene_synonym="HMG14"
ORIGIN
ggggaggaggaggcgggctcccaatccggttccatccggttctcccaccgcccccgctgtgggtctcagcagctcgggcggcgggaggagtggcagcggcaaggcagcccagtttcgcgaaggctgtcggcgcgccgcggcccgcaggcacccggcacgcgccttccccgcaggcacccggcacgcgccttccccgccgccacgatgcccaagaggaaggtcagctccgccgaaggcgccgccaaggaagagcccaagaggagatcggcgcggttgtcagctaaacctcctgcaaaagtggaagcgaagccgaaaaaggcagcagcgaaggataaatcttcagacaaaaaagtgcaaacaaaagggaaaaggggagcaaagggaaaacaggccgaagtggctaaccaagaaactaaagaagacttacctgcggaaaacggggaaacgaagactgaggagagtccagcctctgatgaagcaggagagaaagaagccaagtctgattaataaccatataccatgtcttatcagtggtccctgtctcccttcttgtacaatccagaggaatatttttatcaactattttgtaaatgcaagttttttagtagctctagaaacatttttaagaaggagggaatcccacctcatcccattttttaagtgtaaatgcttttttttaagaggtgaaatcatttgctggttgtttattttttggtacaaccagaaaatagtgtgggatattgaattatgggaggctctgactgtctcgggtgtcagcttaacattccacagatggggggttagtttttatatcctataatacaaagcatattaaatggcaatatggagtcagtcctgcatttaatgtcttgaacattttaaattacttctattaccatgttgttttttagtagaattgtttcctaaagaaaaccactctttgatcatggctctctctgccagaattgtgtgcactctgtaacatctttgtggtagtcctgttttcctaataactttgttactgtgctgtgaaagattacagatttgaacatgtagtgtacgtgctgttgagttgtgaactggtgggccgtatgtaacagctgaccaacgtgaagatactggtacttgatagcctcttaaggaaaatttgcttccaaattttaagctggaaagtcactggaataactttaaaaaagaattacaatacatggctttttagaatttcgttacgtatgttaagatttgtgtacaaattgaaatgtctgtactgatcctcaaccaataaaatctcagttatgaaaataaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:3150 -> Molecular function: GO:0003677 [DNA binding] evidence: TAS
GeneID:3150 -> Molecular function: GO:0031492 [nucleosomal DNA binding] evidence: IEA
GeneID:3150 -> Biological process: GO:0000720 [pyrimidine dimer repair by nucleotide-excision repair] evidence: IEA
GeneID:3150 -> Biological process: GO:0006283 [transcription-coupled nucleotide-excision repair] evidence: IEA
GeneID:3150 -> Biological process: GO:0006325 [chromatin organization] evidence: IEA
GeneID:3150 -> Biological process: GO:0006357 [regulation of transcription from RNA polymerase II promoter] evidence: IEA
GeneID:3150 -> Biological process: GO:0010224 [response to UV-B] evidence: IEA
GeneID:3150 -> Biological process: GO:0010225 [response to UV-C] evidence: IEA
GeneID:3150 -> Biological process: GO:0032786 [positive regulation of DNA-dependent transcription, elongation] evidence: TAS
GeneID:3150 -> Biological process: GO:0040034 [regulation of development, heterochronic] evidence: IEA
GeneID:3150 -> Biological process: GO:0048597 [post-embryonic camera-type eye morphogenesis] evidence: IEA
GeneID:3150 -> Biological process: GO:0050678 [regulation of epithelial cell proliferation] evidence: IEA
GeneID:3150 -> Cellular component: GO:0000785 [chromatin] evidence: IEA
GeneID:3150 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:3150 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.