Home |
Help |
Advanced search
2024-04-25 21:44:25, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004931 1433 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens CD8b molecule (CD8B), transcript variant 5, mRNA.
ACCESSION NM_004931
VERSION NM_004931.4 GI:296010931
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1433)
AUTHORS Heigele,A., Schindler,M., Gnanadurai,C.W., Leonard,J.A.,
Collins,K.L. and Kirchhoff,F.
TITLE Down-modulation of CD8alphabeta is a fundamental activity of
primate lentiviral Nef proteins
JOURNAL J. Virol. 86 (1), 36-48 (2012)
PUBMED 22013062
REMARK GeneRIF: Nef-mediated down-modulation of CD8alphabeta is a
fundamental property of primate lentiviruses.
REFERENCE 2 (bases 1 to 1433)
AUTHORS Laugel,B., Cole,D.K., Clement,M., Wooldridge,L., Price,D.A. and
Sewell,A.K.
TITLE The multiple roles of the CD8 coreceptor in T cell biology:
opportunities for the selective modulation of self-reactive
cytotoxic T cells
JOURNAL J. Leukoc. Biol. 90 (6), 1089-1099 (2011)
PUBMED 21954283
REMARK GeneRIF: [review] Coreceptor CD8alphabeta contributes to the
antigen-recognition process by binding to a largely invariant
region of the MHCI molecule and by promoting intracellular
signaling.
Review article
REFERENCE 3 (bases 1 to 1433)
AUTHORS Hoglinger,G.U., Melhem,N.M., Dickson,D.W., Sleiman,P.M., Wang,L.S.,
Klei,L., Rademakers,R., de Silva,R., Litvan,I., Riley,D.E., van
Swieten,J.C., Heutink,P., Wszolek,Z.K., Uitti,R.J., Vandrovcova,J.,
Hurtig,H.I., Gross,R.G., Maetzler,W., Goldwurm,S., Tolosa,E.,
Borroni,B., Pastor,P., Cantwell,L.B., Han,M.R., Dillman,A., van der
Brug,M.P., Gibbs,J.R., Cookson,M.R., Hernandez,D.G.,
Singleton,A.B., Farrer,M.J., Yu,C.E., Golbe,L.I., Revesz,T.,
Hardy,J., Lees,A.J., Devlin,B., Hakonarson,H., Muller,U. and
Schellenberg,G.D.
CONSRTM PSP Genetics Study Group
TITLE Identification of common variants influencing risk of the tauopathy
progressive supranuclear palsy
JOURNAL Nat. Genet. 43 (7), 699-705 (2011)
PUBMED 21685912
REMARK Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1433)
AUTHORS Chen,M.L., Yan,B.S., Kozoriz,D. and Weiner,H.L.
TITLE Novel CD8+ Treg suppress EAE by TGF-beta- and IFN-gamma-dependent
mechanisms
JOURNAL Eur. J. Immunol. 39 (12), 3423-3435 (2009)
PUBMED 19768696
REMARK GeneRIF: Data show that CD8+LAP+ cells produce IFN-gamma, and these
cells suppress EAE that is dependent on both TGF-beta and
IFN-gamma.
REFERENCE 5 (bases 1 to 1433)
AUTHORS Thakral,D., Dobbins,J., Devine,L. and Kavathas,P.B.
TITLE Differential expression of the human CD8beta splice variants and
regulation of the M-2 isoform by ubiquitination
JOURNAL J. Immunol. 180 (11), 7431-7442 (2008)
PUBMED 18490743
REMARK GeneRIF: study demonstrated differential mRNA expression patterns
of CD8beta splice variants in thymocytes and in resting, memory,
and activated primary CD8(+) T cells
REFERENCE 6 (bases 1 to 1433)
AUTHORS Nakayama,K., Kawachi,Y., Tokito,S., Minami,N., Yamamoto,R.,
Imai,T., Gachelin,G. and Nakauchi,H.
TITLE Recent duplication of the two human CD8 beta-chain genes
JOURNAL J. Immunol. 148 (6), 1919-1927 (1992)
PUBMED 1541829
REFERENCE 7 (bases 1 to 1433)
AUTHORS Terry,L.A., DiSanto,J.P., Small,T.N. and Flomenberg,N.
TITLE Differential expression and regulation of the human CD8 alpha and
CD8 beta chains
JOURNAL Tissue Antigens 35 (2), 82-91 (1990)
PUBMED 2111591
REFERENCE 8 (bases 1 to 1433)
AUTHORS Parnes,J.R.
TITLE Molecular biology and function of CD4 and CD8
JOURNAL Adv. Immunol. 44, 265-311 (1989)
PUBMED 2493728
REMARK Review article
REFERENCE 9 (bases 1 to 1433)
AUTHORS Norment,A.M. and Littman,D.R.
TITLE A second subunit of CD8 is expressed in human T cells
JOURNAL EMBO J. 7 (11), 3433-3439 (1988)
PUBMED 3145195
REFERENCE 10 (bases 1 to 1433)
AUTHORS Johnson,P.
TITLE A human homolog of the mouse CD8 molecule, Lyt-3: genomic sequence
and expression
JOURNAL Immunogenetics 26 (3), 174-177 (1987)
PUBMED 3114136
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DC405359.1, BC100912.2,
X13444.1, AC111200.7, DB223179.1 and BP392114.1.
On May 13, 2010 this sequence version replaced gi:90421320.
Summary: The CD8 antigen is a cell surface glycoprotein found on
most cytotoxic T lymphocytes that mediates efficient cell-cell
interactions within the immune system. The CD8 antigen, acting as a
coreceptor, and the T-cell receptor on the T lymphocyte recognize
antigens displayed by an antigen presenting cell (APC) in the
context of class I MHC molecules. The functional coreceptor is
either a homodimer composed of two alpha chains, or a heterodimer
composed of one alpha and one beta chain. Both alpha and beta
chains share significant homology to immunoglobulin variable light
chains. This gene encodes the CD8 beta chain isoforms. Multiple
alternatively spliced transcript variants encoding distinct
membrane associated or secreted isoforms have been described. A
pseudogene, also located on chromosome 2, has been identified.
[provided by RefSeq, May 2010].
Transcript Variant: This variant (5), also known as M-1, differs in
the 3' coding region and 3' UTR, compared to variant 1. The
resulting isoform (2) has a distinct C-terminus and is shorter than
isoform 2.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: M36712.1, Y00805.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025088 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-83 DC405359.1 1-83
84-84 BC100912.2 75-75
85-690 X13444.1 76-681
691-886 AC111200.7 8227-8422 c
887-1339 DB223179.1 1-453
1340-1340 BP392114.1 427-427
1341-1433 DB223179.1 455-547
FEATURES Location/Qualifiers
source 1..1433
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="2"
/map="2p12"
gene 1..1433
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/note="CD8b molecule"
/db_xref="GeneID:926"
/db_xref="HGNC:1707"
/db_xref="HPRD:01725"
/db_xref="MIM:186730"
exon 1..102
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/inference="alignment:Splign:1.39.8"
CDS 60..692
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/note="isoform 5 precursor is encoded by transcript
variant 5; CD8 antigen, beta polypeptide 1 (p37); T
lymphocyte surface glycoprotein beta chain"
/codon_start=1
/product="T-cell surface glycoprotein CD8 beta chain
isoform 5 precursor"
/protein_id="NP_004922.1"
/db_xref="GI:4826667"
/db_xref="CCDS:CCDS1997.1"
/db_xref="GeneID:926"
/db_xref="HGNC:1707"
/db_xref="HPRD:01725"
/db_xref="MIM:186730"
/translation="
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK
"
sig_peptide 60..122
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
misc_feature 117..461
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/note="Immunoglobulin V-set domain; Region: V-set;
pfam07686"
/db_xref="CDD:203725"
mat_peptide 123..689
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/product="T-cell surface glycoprotein CD8 beta chain
isoform 5"
misc_feature 144..461
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/note="Immunoglobulin (Ig) like domain of CD8 beta chain;
Region: IgV_CD8_beta; cd07700"
/db_xref="CDD:143324"
misc_feature order(216..218,228..230,258..260,264..266,414..416,
435..440)
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/note="heterodimer interface [polypeptide binding]; other
site"
/db_xref="CDD:143324"
misc_feature 477..479
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
/db_xref="HPRD:00084"
misc_feature 480..482
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
/db_xref="HPRD:00084"
misc_feature 492..494
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
/db_xref="HPRD:00084"
misc_feature 504..506
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
/db_xref="HPRD:00084"
misc_feature 570..632
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P10966.1);
transmembrane region"
exon 103..462
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/inference="alignment:Splign:1.39.8"
variation 210
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/replace="c"
/replace="t"
/db_xref="dbSNP:11558603"
exon 463..552
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/inference="alignment:Splign:1.39.8"
exon 553..642
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/inference="alignment:Splign:1.39.8"
variation 570
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/replace="a"
/replace="g"
/db_xref="dbSNP:1126875"
variation 597
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/replace="a"
/replace="g"
/db_xref="dbSNP:2228022"
variation 632
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/replace="c"
/replace="g"
/db_xref="dbSNP:1126874"
exon 643..679
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/inference="alignment:Splign:1.39.8"
exon 680..1433
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/inference="alignment:Splign:1.39.8"
STS 763..940
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/standard_name="D2S2568"
/db_xref="UniSTS:44014"
STS 1063..1281
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/standard_name="RH70958"
/db_xref="UniSTS:2826"
variation 1208
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/replace="c"
/replace="g"
/db_xref="dbSNP:3088385"
variation 1295
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/replace="c"
/replace="t"
/db_xref="dbSNP:1803262"
polyA_signal 1390..1395
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
polyA_site 1413
/gene="CD8B"
/gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
/note="The 3'-most polyA site has not been determined.
This is an internal polyA site."
ORIGIN
accccagccgcgactgtctccgccgagcccccggggccaggtgtcccgggcgcgccacgatgcggccgcggctgtggctcctcttggccgcgcagctgacagttctccatggcaactcagtcctccagcagacccctgcatacataaaggtgcaaaccaacaagatggtgatgctgtcctgcgaggctaaaatctccctcagtaacatgcgcatctactggctgagacagcgccaggcaccgagcagtgacagtcaccacgagttcctggccctctgggattccgcaaaagggactatccacggtgaagaggtggaacaggagaagatagctgtgtttcgggatgcaagccggttcattctcaatctcacaagcgtgaagccggaagacagtggcatctacttctgcatgatcgtcgggagccccgagctgaccttcgggaagggaactcagctgagtgtggttgatttccttcccaccactgcccagcccaccaagaagtccaccctcaagaagagagtgtgccggttacccaggccagagacccagaagggcccactttgtagccccatcacccttggcctgctggtggctggcgtcctggttctgctggtttccctgggagtggccatccacctgtgctgccggcggaggagagcccggcttcgtttcatgaaacaattttacaaatgagcagagaatacggttttggtgtcctgctacaaaaagacatcggtcagtaacgagcacgatgtggaaaaatgagagaagggacacattcaaccctggagagttcaatggctgctgaagctgcctgcttttcactgctgcaaggcctttctgtgtgtgatgtgcatgggagcaacttgttcgtgggtcatcgggaatactagggagaaggtttcattgcccccagggcacttcacagagtgtgctggaggactgagtaagaaatgctgcccatgccaccgcttccggctcctgtgctttccctgaactgggacctttagtggtggccatttagccaccatctttgcaggttgctttgccctggtagggcagtaacattgggtcctgggtctttcatggggtgatgctgggctggctccctcttggtcttcccaggctggggctgaccttcctcgcagagaggccaggtgcaggttgggaatgaggcttgctgagaggggctgtccagttcccagaaggcatatcagtctctgagggcttcctttggggccgggaacttgcgggtttgaggataggagttcacttcatcttctcagctcccatttctactcttaagtttctcagctcccatttctactctcccatggcttaatgcttctttcattttctgtttgttttatacaaatgtcttagttgtacaaataaagtcccaggttaaagataacaaacggctcctgtgacata
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:926 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:926 -> Molecular function: GO:0015026 [coreceptor activity] evidence: NAS
GeneID:926 -> Molecular function: GO:0042288 [MHC class I protein binding] evidence: NAS
GeneID:926 -> Biological process: GO:0006955 [immune response] evidence: NAS
GeneID:926 -> Biological process: GO:0007169 [transmembrane receptor protein tyrosine kinase signaling pathway] evidence: NAS
GeneID:926 -> Biological process: GO:0016032 [viral process] evidence: TAS
GeneID:926 -> Biological process: GO:0042110 [T cell activation] evidence: NAS
GeneID:926 -> Biological process: GO:0050690 [regulation of defense response to virus by virus] evidence: TAS
GeneID:926 -> Biological process: GO:0050776 [regulation of immune response] evidence: TAS
GeneID:926 -> Cellular component: GO:0005576 [extracellular region] evidence: IEA
GeneID:926 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
GeneID:926 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS
GeneID:926 -> Cellular component: GO:0009897 [external side of plasma membrane] evidence: IEA
GeneID:926 -> Cellular component: GO:0031901 [early endosome membrane] evidence: TAS
GeneID:926 -> Cellular component: GO:0042101 [T cell receptor complex] evidence: NAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.