2024-04-25 04:52:45, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004740 2110 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens TGFB1-induced anti-apoptotic factor 1 (TIAF1), mRNA. ACCESSION NM_004740 VERSION NM_004740.3 GI:42741656 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2110) AUTHORS Chang,J.Y., Chiang,M.F., Lin,S.R., Lee,M.H., He,H., Chou,P.Y., Chen,S.J., Chen,Y.A., Yang,L.Y., Lai,F.J., Hsieh,C.C., Hsieh,T.H., Sheu,H.M., Sze,C.I. and Chang,N.S. TITLE TIAF1 self-aggregation in peritumor capsule formation, spontaneous activation of SMAD-responsive promoter in p53-deficient environment, and cell death JOURNAL Cell Death Dis 3, E302 (2012) PUBMED 22534828 REMARK GeneRIF: In vitro induction of TIAF1 self-association upregulated the expression of tumor suppressors Smad4 and WW domain-containing oxidoreductase (WOX1 or WWOX), and WOX1 in turn increased the TIAF1 expression. Publication Status: Online-Only REFERENCE 2 (bases 1 to 2110) AUTHORS Lee,M.H., Lin,S.R., Chang,J.Y., Schultz,L., Heath,J., Hsu,L.J., Kuo,Y.M., Hong,Q., Chiang,M.F., Gong,C.X., Sze,C.I. and Chang,N.S. TITLE TGF-beta induces TIAF1 self-aggregation via type II receptor-independent signaling that leads to generation of amyloid beta plaques in Alzheimer's disease JOURNAL Cell Death Dis 1, E110 (2010) PUBMED 21368882 REMARK GeneRIF: TIAF1 undergoes self-aggregation in response to TGF-Beta1. Publication Status: Online-Only REFERENCE 3 (bases 1 to 2110) AUTHORS Homma,K., Kikuno,R.F., Nagase,T., Ohara,O. and Nishikawa,K. TITLE Alternative splice variants encoding unstable protein domains exist in the human brain JOURNAL J. Mol. Biol. 343 (5), 1207-1220 (2004) PUBMED 15491607 REFERENCE 4 (bases 1 to 2110) AUTHORS Brajenovic,M., Joberty,G., Kuster,B., Bouwmeester,T. and Drewes,G. TITLE Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network JOURNAL J. Biol. Chem. 279 (13), 12804-12811 (2004) PUBMED 14676191 REFERENCE 5 (bases 1 to 2110) AUTHORS Schultz,L., Khera,S., Sleve,D., Heath,J. and Chang,N.S. TITLE TIAF1 and p53 functionally interact in mediating apoptosis and silencing of TIAF1 abolishes nuclear translocation of serine 15-phosphorylated p53 JOURNAL DNA Cell Biol. 23 (1), 67-74 (2004) PUBMED 14965474 REMARK GeneRIF: TIAF1 and p53 functionally interact in regulating apoptosis, and TIAF1 is likely to participate in the nuclear translocation of activated p53. REFERENCE 6 (bases 1 to 2110) AUTHORS van der Leij,J., van den Berg,A., Albrecht,E.W., Blokzijl,T., Roozendaal,R., Gouw,A.S., de Jong,K.P., Stegeman,C.A., van Goor,H., Chang,N.S. and Poppema,S. TITLE High expression of TIAF-1 in chronic kidney and liver allograft rejection and in activated T-helper cells JOURNAL Transplantation 75 (12), 2076-2082 (2003) PUBMED 12829915 REMARK GeneRIF: Expression of TIAF-1 in the lymphocytes during chronic allograft rejection may be related to the predominance of a Th2 response in this condition and may protect these cells from apoptosis REFERENCE 7 (bases 1 to 2110) AUTHORS Chang,N.S., Mattison,J., Cao,H., Pratt,N., Zhao,Y. and Lee,C. TITLE Cloning and characterization of a novel transforming growth factor-beta1-induced TIAF1 protein that inhibits tumor necrosis factor cytotoxicity JOURNAL Biochem. Biophys. Res. Commun. 253 (3), 743-749 (1998) PUBMED 9918798 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK126861.1 and BC047669.1. On Feb 23, 2004 this sequence version replaced gi:17978508. ##Evidence-Data-START## Transcript is intronless :: AK054958.1 [ECO:0000345] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2089 AK126861.1 1698-3786 2090-2110 BC047669.1 1387-1407 FEATURES Location/Qualifiers source 1..2110 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="17" /map="17q11.2" gene 1..2110 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /note="TGFB1-induced anti-apoptotic factor 1" /db_xref="GeneID:9220" /db_xref="HGNC:11803" /db_xref="HPRD:10268" /db_xref="MIM:609517" exon 1..2089 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /inference="alignment:Splign:1.39.8" variation 1117 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:11539071" STS 1325..1480 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /standard_name="D17S1502E" /db_xref="UniSTS:151707" misc_feature 1357..1359 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /note="upstream in-frame stop codon" CDS 1411..1758 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /note="TGF-beta-1-induced antiapoptotic factor 1; molecule associated with Jak-3 N-terminal; 12 kDa TGF-beta-1-induced antiapoptotic factor" /codon_start=1 /product="TGFB1-induced anti-apoptotic factor 1" /protein_id="NP_004731.2" /db_xref="GI:17978509" /db_xref="CCDS:CCDS32599.1" /db_xref="GeneID:9220" /db_xref="HGNC:11803" /db_xref="HPRD:10268" /db_xref="MIM:609517" /translation="
MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
" variation 1452 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /replace="c" /replace="g" /db_xref="dbSNP:1049848" STS 1460..1630 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /standard_name="RH68312" /db_xref="UniSTS:87897" variation 1556 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /replace="c" /replace="t" /db_xref="dbSNP:1049849" variation 1807 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /replace="a" /replace="t" /db_xref="dbSNP:1803474" variation 1849 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /replace="c" /replace="t" /db_xref="dbSNP:1049864" STS 1885..2068 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /standard_name="RH67783" /db_xref="UniSTS:92386" variation 1901 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /replace="c" /replace="t" /db_xref="dbSNP:11539070" variation 1919 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /replace="a" /replace="c" /db_xref="dbSNP:1049869" STS 1946..2076 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /standard_name="RH39291" /db_xref="UniSTS:86988" variation 1948 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /replace="a" /replace="c" /db_xref="dbSNP:1049870" variation 2006 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /replace="c" /replace="t" /db_xref="dbSNP:1049877" variation 2008 /gene="TIAF1" /gene_synonym="MAJN; SPR210" /replace="c" /replace="t" /db_xref="dbSNP:1049878" polyA_signal 2068..2073 /gene="TIAF1" /gene_synonym="MAJN; SPR210" polyA_site 2089 /gene="TIAF1" /gene_synonym="MAJN; SPR210" ORIGIN
cagaggcctgatgaagactctgagttatgttattgtaccaagaaaggggcttttccccttgggccatcctaaaacaggtcttcccagcctctccttcctgagcctccatttcttgttagtagatgatggcatggtcaaagctgaaaattctcacaggcctcagggagccatcattaggggaaagggttcagatctgggagtatttgacagggaaagcgcctcctcctcagaaggaatctttttaggaatcactcgcctaagagagcccctaccctagacaagttgtactcaccagacctccagtctccaagccaatgtggttcacggactgcctgcttcagagccttctggggaaggactgaaaatgcagaattactgggttgtacccaaaagccagcgattcaaggtttctaagaggaagggcccaggaacctgcatcagattcttatgcacgcttgagtccgagactcactgctctcagcatccctttcctcggagctttaaaagcttccagagtctccttcctcttagcattttgagtatcttctaagtaagccaaggaaggtttttacttaacaatgtttggcttttggggagtgctctgacgcagctttgtgggcctccagaaccaaaggcgtgcgtgcttaatggtaggagtgtcatttgtccctaaccttattcctcggtccctgcagccccaccagctactggaagtcccttgcccctgatcggtcagatgatgagcacgaccctctcgacaacacctccagaccgcgatactcccacagttatctgagtgacagcgacacagaggccaagctgacggagactaacgcatagcccaggggagtggttggcagccctctcaccccagggcctgtggctgcctgggcacctctcccaggaagtggtggggcaccggtctcccccacccgactgctgatctgcatgggaaacaccctgaccttcttctgtcaggggcactttccaggctatgggtgtctgatgtctccacgtggaagaggtgggggaaagaggagtttctgaagagaactttttgctcctctgtctcaaaatgccagactcttggcttctaccctgtgtcaccgtgggcagtggcaggtggcctggcactgcatggagccagcacgttgacctccctctcagctccctgctcagggacggtggacaggttgcctactgggacactctaggttgctgggtccatggggaggattgggggaggagaagcagtgccttccctctcgtgtggggtgggggctctctcttcttggtgcctgctgtctttctactttttaatttaaatacccaacctctccatcacagctgcatccctgagagtgggagggggctgtagtggtagctggggctcccaagaacgactcgggaatgtcatctccatcttcacccttcagagagcagtcctttctctgtgcagctggagacgctggtgaggagagccgggtccaggttcttaagaatgaggtgcggaggggctctccggtgctgctgggctgggttgagcaagcctacgcagacaagtgtgtgtgtggaccatccgcacctccagcccccaccccaccctctttgtctcagcgtgttatgtgcaatgacctatttaaggtaaacccattccaactacagcagttcagggctgatccaagcactgcctccctcctgctctgtccaggtggtctggaccataaactcaacttgagagggaaggcttggggttgaggacttgtgatcagaaaaactgaagatggaagttttggccggtgctcattagacatgagtcctcactctgtgtcctgagcccgtgtcattcttccaacctccctgcccccacacacttatcccagacacaacaccatgtggtctggaggtcccagcccccaccctaaaaaggttatccctgagaactccaccagacttgggagcccaagtgcagtgcctggtgctgctcccatctgccgccccccttctctcctgcaattggtttgtactcactgggctgtgctctcccctgtttacccgatgtatggaaataaaggcccttttcctcctgaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:9220 -> Molecular function: GO:0003674 [molecular_function] evidence: ND GeneID:9220 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:9220 -> Biological process: GO:0007249 [I-kappaB kinase/NF-kappaB cascade] evidence: IDA GeneID:9220 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IDA GeneID:9220 -> Cellular component: GO:0005634 [nucleus] evidence: NAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.