GGRNA Home | Help | Advanced search

2024-04-25 04:52:45, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_004740               2110 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens TGFB1-induced anti-apoptotic factor 1 (TIAF1), mRNA.
ACCESSION   NM_004740
VERSION     NM_004740.3  GI:42741656
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2110)
  AUTHORS   Chang,J.Y., Chiang,M.F., Lin,S.R., Lee,M.H., He,H., Chou,P.Y.,
            Chen,S.J., Chen,Y.A., Yang,L.Y., Lai,F.J., Hsieh,C.C., Hsieh,T.H.,
            Sheu,H.M., Sze,C.I. and Chang,N.S.
  TITLE     TIAF1 self-aggregation in peritumor capsule formation, spontaneous
            activation of SMAD-responsive promoter in p53-deficient
            environment, and cell death
  JOURNAL   Cell Death Dis 3, E302 (2012)
   PUBMED   22534828
  REMARK    GeneRIF: In vitro induction of TIAF1 self-association upregulated
            the expression of tumor suppressors Smad4 and WW domain-containing
            oxidoreductase (WOX1 or WWOX), and WOX1 in turn increased the TIAF1
            expression.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2110)
  AUTHORS   Lee,M.H., Lin,S.R., Chang,J.Y., Schultz,L., Heath,J., Hsu,L.J.,
            Kuo,Y.M., Hong,Q., Chiang,M.F., Gong,C.X., Sze,C.I. and Chang,N.S.
  TITLE     TGF-beta induces TIAF1 self-aggregation via type II
            receptor-independent signaling that leads to generation of amyloid
            beta plaques in Alzheimer's disease
  JOURNAL   Cell Death Dis 1, E110 (2010)
   PUBMED   21368882
  REMARK    GeneRIF: TIAF1 undergoes self-aggregation in response to TGF-Beta1.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2110)
  AUTHORS   Homma,K., Kikuno,R.F., Nagase,T., Ohara,O. and Nishikawa,K.
  TITLE     Alternative splice variants encoding unstable protein domains exist
            in the human brain
  JOURNAL   J. Mol. Biol. 343 (5), 1207-1220 (2004)
   PUBMED   15491607
REFERENCE   4  (bases 1 to 2110)
  AUTHORS   Brajenovic,M., Joberty,G., Kuster,B., Bouwmeester,T. and Drewes,G.
  TITLE     Comprehensive proteomic analysis of human Par protein complexes
            reveals an interconnected protein network
  JOURNAL   J. Biol. Chem. 279 (13), 12804-12811 (2004)
   PUBMED   14676191
REFERENCE   5  (bases 1 to 2110)
  AUTHORS   Schultz,L., Khera,S., Sleve,D., Heath,J. and Chang,N.S.
  TITLE     TIAF1 and p53 functionally interact in mediating apoptosis and
            silencing of TIAF1 abolishes nuclear translocation of serine
            15-phosphorylated p53
  JOURNAL   DNA Cell Biol. 23 (1), 67-74 (2004)
   PUBMED   14965474
  REMARK    GeneRIF: TIAF1 and p53 functionally interact in regulating
            apoptosis, and TIAF1 is likely to participate in the nuclear
            translocation of activated p53.
REFERENCE   6  (bases 1 to 2110)
  AUTHORS   van der Leij,J., van den Berg,A., Albrecht,E.W., Blokzijl,T.,
            Roozendaal,R., Gouw,A.S., de Jong,K.P., Stegeman,C.A., van Goor,H.,
            Chang,N.S. and Poppema,S.
  TITLE     High expression of TIAF-1 in chronic kidney and liver allograft
            rejection and in activated T-helper cells
  JOURNAL   Transplantation 75 (12), 2076-2082 (2003)
   PUBMED   12829915
  REMARK    GeneRIF: Expression of TIAF-1 in the lymphocytes during chronic
            allograft rejection may be related to the predominance of a Th2
            response in this condition and may protect these cells from
            apoptosis
REFERENCE   7  (bases 1 to 2110)
  AUTHORS   Chang,N.S., Mattison,J., Cao,H., Pratt,N., Zhao,Y. and Lee,C.
  TITLE     Cloning and characterization of a novel transforming growth
            factor-beta1-induced TIAF1 protein that inhibits tumor necrosis
            factor cytotoxicity
  JOURNAL   Biochem. Biophys. Res. Commun. 253 (3), 743-749 (1998)
   PUBMED   9918798
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AK126861.1 and BC047669.1.
            On Feb 23, 2004 this sequence version replaced gi:17978508.
            
            ##Evidence-Data-START##
            Transcript is intronless :: AK054958.1 [ECO:0000345]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-2089              AK126861.1         1698-3786
            2090-2110           BC047669.1         1387-1407
FEATURES             Location/Qualifiers
     source          1..2110
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q11.2"
     gene            1..2110
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /note="TGFB1-induced anti-apoptotic factor 1"
                     /db_xref="GeneID:9220"
                     /db_xref="HGNC:11803"
                     /db_xref="HPRD:10268"
                     /db_xref="MIM:609517"
     exon            1..2089
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /inference="alignment:Splign:1.39.8"
     variation       1117
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11539071"
     STS             1325..1480
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /standard_name="D17S1502E"
                     /db_xref="UniSTS:151707"
     misc_feature    1357..1359
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /note="upstream in-frame stop codon"
     CDS             1411..1758
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /note="TGF-beta-1-induced antiapoptotic factor 1; molecule
                     associated with Jak-3 N-terminal; 12 kDa
                     TGF-beta-1-induced antiapoptotic factor"
                     /codon_start=1
                     /product="TGFB1-induced anti-apoptotic factor 1"
                     /protein_id="NP_004731.2"
                     /db_xref="GI:17978509"
                     /db_xref="CCDS:CCDS32599.1"
                     /db_xref="GeneID:9220"
                     /db_xref="HGNC:11803"
                     /db_xref="HPRD:10268"
                     /db_xref="MIM:609517"
                     /translation="
MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
"
     variation       1452
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1049848"
     STS             1460..1630
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /standard_name="RH68312"
                     /db_xref="UniSTS:87897"
     variation       1556
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1049849"
     variation       1807
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1803474"
     variation       1849
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1049864"
     STS             1885..2068
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /standard_name="RH67783"
                     /db_xref="UniSTS:92386"
     variation       1901
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11539070"
     variation       1919
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1049869"
     STS             1946..2076
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /standard_name="RH39291"
                     /db_xref="UniSTS:86988"
     variation       1948
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1049870"
     variation       2006
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1049877"
     variation       2008
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1049878"
     polyA_signal    2068..2073
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
     polyA_site      2089
                     /gene="TIAF1"
                     /gene_synonym="MAJN; SPR210"
ORIGIN      
cagaggcctgatgaagactctgagttatgttattgtaccaagaaaggggcttttccccttgggccatcctaaaacaggtcttcccagcctctccttcctgagcctccatttcttgttagtagatgatggcatggtcaaagctgaaaattctcacaggcctcagggagccatcattaggggaaagggttcagatctgggagtatttgacagggaaagcgcctcctcctcagaaggaatctttttaggaatcactcgcctaagagagcccctaccctagacaagttgtactcaccagacctccagtctccaagccaatgtggttcacggactgcctgcttcagagccttctggggaaggactgaaaatgcagaattactgggttgtacccaaaagccagcgattcaaggtttctaagaggaagggcccaggaacctgcatcagattcttatgcacgcttgagtccgagactcactgctctcagcatccctttcctcggagctttaaaagcttccagagtctccttcctcttagcattttgagtatcttctaagtaagccaaggaaggtttttacttaacaatgtttggcttttggggagtgctctgacgcagctttgtgggcctccagaaccaaaggcgtgcgtgcttaatggtaggagtgtcatttgtccctaaccttattcctcggtccctgcagccccaccagctactggaagtcccttgcccctgatcggtcagatgatgagcacgaccctctcgacaacacctccagaccgcgatactcccacagttatctgagtgacagcgacacagaggccaagctgacggagactaacgcatagcccaggggagtggttggcagccctctcaccccagggcctgtggctgcctgggcacctctcccaggaagtggtggggcaccggtctcccccacccgactgctgatctgcatgggaaacaccctgaccttcttctgtcaggggcactttccaggctatgggtgtctgatgtctccacgtggaagaggtgggggaaagaggagtttctgaagagaactttttgctcctctgtctcaaaatgccagactcttggcttctaccctgtgtcaccgtgggcagtggcaggtggcctggcactgcatggagccagcacgttgacctccctctcagctccctgctcagggacggtggacaggttgcctactgggacactctaggttgctgggtccatggggaggattgggggaggagaagcagtgccttccctctcgtgtggggtgggggctctctcttcttggtgcctgctgtctttctactttttaatttaaatacccaacctctccatcacagctgcatccctgagagtgggagggggctgtagtggtagctggggctcccaagaacgactcgggaatgtcatctccatcttcacccttcagagagcagtcctttctctgtgcagctggagacgctggtgaggagagccgggtccaggttcttaagaatgaggtgcggaggggctctccggtgctgctgggctgggttgagcaagcctacgcagacaagtgtgtgtgtggaccatccgcacctccagcccccaccccaccctctttgtctcagcgtgttatgtgcaatgacctatttaaggtaaacccattccaactacagcagttcagggctgatccaagcactgcctccctcctgctctgtccaggtggtctggaccataaactcaacttgagagggaaggcttggggttgaggacttgtgatcagaaaaactgaagatggaagttttggccggtgctcattagacatgagtcctcactctgtgtcctgagcccgtgtcattcttccaacctccctgcccccacacacttatcccagacacaacaccatgtggtctggaggtcccagcccccaccctaaaaaggttatccctgagaactccaccagacttgggagcccaagtgcagtgcctggtgctgctcccatctgccgccccccttctctcctgcaattggtttgtactcactgggctgtgctctcccctgtttacccgatgtatggaaataaaggcccttttcctcctgaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:9220 -> Molecular function: GO:0003674 [molecular_function] evidence: ND
            GeneID:9220 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
            GeneID:9220 -> Biological process: GO:0007249 [I-kappaB kinase/NF-kappaB cascade] evidence: IDA
            GeneID:9220 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IDA
            GeneID:9220 -> Cellular component: GO:0005634 [nucleus] evidence: NAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.