Home |
Help |
Advanced search
2024-04-20 11:04:27, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004740 2110 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens TGFB1-induced anti-apoptotic factor 1 (TIAF1), mRNA.
ACCESSION NM_004740
VERSION NM_004740.3 GI:42741656
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2110)
AUTHORS Chang,J.Y., Chiang,M.F., Lin,S.R., Lee,M.H., He,H., Chou,P.Y.,
Chen,S.J., Chen,Y.A., Yang,L.Y., Lai,F.J., Hsieh,C.C., Hsieh,T.H.,
Sheu,H.M., Sze,C.I. and Chang,N.S.
TITLE TIAF1 self-aggregation in peritumor capsule formation, spontaneous
activation of SMAD-responsive promoter in p53-deficient
environment, and cell death
JOURNAL Cell Death Dis 3, E302 (2012)
PUBMED 22534828
REMARK GeneRIF: In vitro induction of TIAF1 self-association upregulated
the expression of tumor suppressors Smad4 and WW domain-containing
oxidoreductase (WOX1 or WWOX), and WOX1 in turn increased the TIAF1
expression.
Publication Status: Online-Only
REFERENCE 2 (bases 1 to 2110)
AUTHORS Lee,M.H., Lin,S.R., Chang,J.Y., Schultz,L., Heath,J., Hsu,L.J.,
Kuo,Y.M., Hong,Q., Chiang,M.F., Gong,C.X., Sze,C.I. and Chang,N.S.
TITLE TGF-beta induces TIAF1 self-aggregation via type II
receptor-independent signaling that leads to generation of amyloid
beta plaques in Alzheimer's disease
JOURNAL Cell Death Dis 1, E110 (2010)
PUBMED 21368882
REMARK GeneRIF: TIAF1 undergoes self-aggregation in response to TGF-Beta1.
Publication Status: Online-Only
REFERENCE 3 (bases 1 to 2110)
AUTHORS Homma,K., Kikuno,R.F., Nagase,T., Ohara,O. and Nishikawa,K.
TITLE Alternative splice variants encoding unstable protein domains exist
in the human brain
JOURNAL J. Mol. Biol. 343 (5), 1207-1220 (2004)
PUBMED 15491607
REFERENCE 4 (bases 1 to 2110)
AUTHORS Brajenovic,M., Joberty,G., Kuster,B., Bouwmeester,T. and Drewes,G.
TITLE Comprehensive proteomic analysis of human Par protein complexes
reveals an interconnected protein network
JOURNAL J. Biol. Chem. 279 (13), 12804-12811 (2004)
PUBMED 14676191
REFERENCE 5 (bases 1 to 2110)
AUTHORS Schultz,L., Khera,S., Sleve,D., Heath,J. and Chang,N.S.
TITLE TIAF1 and p53 functionally interact in mediating apoptosis and
silencing of TIAF1 abolishes nuclear translocation of serine
15-phosphorylated p53
JOURNAL DNA Cell Biol. 23 (1), 67-74 (2004)
PUBMED 14965474
REMARK GeneRIF: TIAF1 and p53 functionally interact in regulating
apoptosis, and TIAF1 is likely to participate in the nuclear
translocation of activated p53.
REFERENCE 6 (bases 1 to 2110)
AUTHORS van der Leij,J., van den Berg,A., Albrecht,E.W., Blokzijl,T.,
Roozendaal,R., Gouw,A.S., de Jong,K.P., Stegeman,C.A., van Goor,H.,
Chang,N.S. and Poppema,S.
TITLE High expression of TIAF-1 in chronic kidney and liver allograft
rejection and in activated T-helper cells
JOURNAL Transplantation 75 (12), 2076-2082 (2003)
PUBMED 12829915
REMARK GeneRIF: Expression of TIAF-1 in the lymphocytes during chronic
allograft rejection may be related to the predominance of a Th2
response in this condition and may protect these cells from
apoptosis
REFERENCE 7 (bases 1 to 2110)
AUTHORS Chang,N.S., Mattison,J., Cao,H., Pratt,N., Zhao,Y. and Lee,C.
TITLE Cloning and characterization of a novel transforming growth
factor-beta1-induced TIAF1 protein that inhibits tumor necrosis
factor cytotoxicity
JOURNAL Biochem. Biophys. Res. Commun. 253 (3), 743-749 (1998)
PUBMED 9918798
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AK126861.1 and BC047669.1.
On Feb 23, 2004 this sequence version replaced gi:17978508.
##Evidence-Data-START##
Transcript is intronless :: AK054958.1 [ECO:0000345]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-2089 AK126861.1 1698-3786
2090-2110 BC047669.1 1387-1407
FEATURES Location/Qualifiers
source 1..2110
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="17"
/map="17q11.2"
gene 1..2110
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/note="TGFB1-induced anti-apoptotic factor 1"
/db_xref="GeneID:9220"
/db_xref="HGNC:11803"
/db_xref="HPRD:10268"
/db_xref="MIM:609517"
exon 1..2089
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/inference="alignment:Splign:1.39.8"
variation 1117
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:11539071"
STS 1325..1480
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/standard_name="D17S1502E"
/db_xref="UniSTS:151707"
misc_feature 1357..1359
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/note="upstream in-frame stop codon"
CDS 1411..1758
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/note="TGF-beta-1-induced antiapoptotic factor 1; molecule
associated with Jak-3 N-terminal; 12 kDa
TGF-beta-1-induced antiapoptotic factor"
/codon_start=1
/product="TGFB1-induced anti-apoptotic factor 1"
/protein_id="NP_004731.2"
/db_xref="GI:17978509"
/db_xref="CCDS:CCDS32599.1"
/db_xref="GeneID:9220"
/db_xref="HGNC:11803"
/db_xref="HPRD:10268"
/db_xref="MIM:609517"
/translation="
MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
"
variation 1452
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/replace="c"
/replace="g"
/db_xref="dbSNP:1049848"
STS 1460..1630
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/standard_name="RH68312"
/db_xref="UniSTS:87897"
variation 1556
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/replace="c"
/replace="t"
/db_xref="dbSNP:1049849"
variation 1807
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/replace="a"
/replace="t"
/db_xref="dbSNP:1803474"
variation 1849
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/replace="c"
/replace="t"
/db_xref="dbSNP:1049864"
STS 1885..2068
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/standard_name="RH67783"
/db_xref="UniSTS:92386"
variation 1901
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/replace="c"
/replace="t"
/db_xref="dbSNP:11539070"
variation 1919
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/replace="a"
/replace="c"
/db_xref="dbSNP:1049869"
STS 1946..2076
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/standard_name="RH39291"
/db_xref="UniSTS:86988"
variation 1948
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/replace="a"
/replace="c"
/db_xref="dbSNP:1049870"
variation 2006
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/replace="c"
/replace="t"
/db_xref="dbSNP:1049877"
variation 2008
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
/replace="c"
/replace="t"
/db_xref="dbSNP:1049878"
polyA_signal 2068..2073
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
polyA_site 2089
/gene="TIAF1"
/gene_synonym="MAJN; SPR210"
ORIGIN
cagaggcctgatgaagactctgagttatgttattgtaccaagaaaggggcttttccccttgggccatcctaaaacaggtcttcccagcctctccttcctgagcctccatttcttgttagtagatgatggcatggtcaaagctgaaaattctcacaggcctcagggagccatcattaggggaaagggttcagatctgggagtatttgacagggaaagcgcctcctcctcagaaggaatctttttaggaatcactcgcctaagagagcccctaccctagacaagttgtactcaccagacctccagtctccaagccaatgtggttcacggactgcctgcttcagagccttctggggaaggactgaaaatgcagaattactgggttgtacccaaaagccagcgattcaaggtttctaagaggaagggcccaggaacctgcatcagattcttatgcacgcttgagtccgagactcactgctctcagcatccctttcctcggagctttaaaagcttccagagtctccttcctcttagcattttgagtatcttctaagtaagccaaggaaggtttttacttaacaatgtttggcttttggggagtgctctgacgcagctttgtgggcctccagaaccaaaggcgtgcgtgcttaatggtaggagtgtcatttgtccctaaccttattcctcggtccctgcagccccaccagctactggaagtcccttgcccctgatcggtcagatgatgagcacgaccctctcgacaacacctccagaccgcgatactcccacagttatctgagtgacagcgacacagaggccaagctgacggagactaacgcatagcccaggggagtggttggcagccctctcaccccagggcctgtggctgcctgggcacctctcccaggaagtggtggggcaccggtctcccccacccgactgctgatctgcatgggaaacaccctgaccttcttctgtcaggggcactttccaggctatgggtgtctgatgtctccacgtggaagaggtgggggaaagaggagtttctgaagagaactttttgctcctctgtctcaaaatgccagactcttggcttctaccctgtgtcaccgtgggcagtggcaggtggcctggcactgcatggagccagcacgttgacctccctctcagctccctgctcagggacggtggacaggttgcctactgggacactctaggttgctgggtccatggggaggattgggggaggagaagcagtgccttccctctcgtgtggggtgggggctctctcttcttggtgcctgctgtctttctactttttaatttaaatacccaacctctccatcacagctgcatccctgagagtgggagggggctgtagtggtagctggggctcccaagaacgactcgggaatgtcatctccatcttcacccttcagagagcagtcctttctctgtgcagctggagacgctggtgaggagagccgggtccaggttcttaagaatgaggtgcggaggggctctccggtgctgctgggctgggttgagcaagcctacgcagacaagtgtgtgtgtggaccatccgcacctccagcccccaccccaccctctttgtctcagcgtgttatgtgcaatgacctatttaaggtaaacccattccaactacagcagttcagggctgatccaagcactgcctccctcctgctctgtccaggtggtctggaccataaactcaacttgagagggaaggcttggggttgaggacttgtgatcagaaaaactgaagatggaagttttggccggtgctcattagacatgagtcctcactctgtgtcctgagcccgtgtcattcttccaacctccctgcccccacacacttatcccagacacaacaccatgtggtctggaggtcccagcccccaccctaaaaaggttatccctgagaactccaccagacttgggagcccaagtgcagtgcctggtgctgctcccatctgccgccccccttctctcctgcaattggtttgtactcactgggctgtgctctcccctgtttacccgatgtatggaaataaaggcccttttcctcctgaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:9220 -> Molecular function: GO:0003674 [molecular_function] evidence: ND
GeneID:9220 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:9220 -> Biological process: GO:0007249 [I-kappaB kinase/NF-kappaB cascade] evidence: IDA
GeneID:9220 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IDA
GeneID:9220 -> Cellular component: GO:0005634 [nucleus] evidence: NAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.