Home |
Help |
Advanced search
2024-04-26 11:18:29, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004708 604 bp mRNA linear PRI 15-JUN-2013
DEFINITION Homo sapiens programmed cell death 5 (PDCD5), mRNA.
ACCESSION NM_004708
VERSION NM_004708.3 GI:313851091
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 604)
CONSRTM GENDEP Investigators; MARS Investigators; STAR*D Investigators
TITLE Common genetic variation and antidepressant efficacy in major
depressive disorder: a meta-analysis of three genome-wide
pharmacogenetic studies
JOURNAL Am J Psychiatry 170 (2), 207-217 (2013)
PUBMED 23377640
REFERENCE 2 (bases 1 to 604)
AUTHORS Gao,F., Ding,L., Zhao,M., Qu,Z., Huang,S. and Zhang,L.
TITLE The clinical significance of reduced programmed cell death 5
expression in human gastrointestinal stromal tumors
JOURNAL Oncol. Rep. 28 (6), 2195-2199 (2012)
PUBMED 22965478
REMARK GeneRIF: results suggest that PDCD5 expression plays a significant
role in the malignant progression of human gastrointestinal stromal
tumors and may be a key inhibitory factor
REFERENCE 3 (bases 1 to 604)
AUTHORS Li,H., Zhang,X., Song,X., Zhu,F., Wang,Q., Guo,C., Liu,C., Shi,Y.,
Ma,C., Wang,X. and Zhang,L.
TITLE PDCD5 promotes cisplatin-induced apoptosis of glioma cells via
activating mitochondrial apoptotic pathway
JOURNAL Cancer Biol. Ther. 13 (9), 822-830 (2012)
PUBMED 22688731
REMARK GeneRIF: PDCD5 promotes chemosensitivity by activating the
mitochondria-related apoptotic pathway.
REFERENCE 4 (bases 1 to 604)
AUTHORS Diao,X.L., Zhu,H., He,B., Pan,H., Wu,R. and Gai,X.Y.
TITLE [Expression and significance of programmed cell death 5 in patients
of branchial asthma]
JOURNAL Zhonghua Yi Xue Za Zhi 92 (20), 1392-1395 (2012)
PUBMED 22883196
REMARK GeneRIF: PDCD5 participates in the inflammatory process of
asthmatic airway. Its abnormal expression may be associated with
the uncontrolled state of asthmatics.
REFERENCE 5 (bases 1 to 604)
AUTHORS Yao,H., Xu,L., Feng,Y., Liu,D., Chen,Y. and Wang,J.
TITLE Structure-function correlation of human programmed cell death 5
protein
JOURNAL Arch. Biochem. Biophys. 486 (2), 141-149 (2009)
PUBMED 19358820
REMARK GeneRIF: Studies of structure-function relationship of PDCD5 by
multidimensional NMR methods and flow cytometer and fluorescence
microscopey.
REFERENCE 6 (bases 1 to 604)
AUTHORS Xu,L., Chen,Y., Song,Q., Xu,D., Wang,Y. and Ma,D.
TITLE PDCD5 interacts with Tip60 and functions as a cooperator in
acetyltransferase activity and DNA damage-induced apoptosis
JOURNAL Neoplasia 11 (4), 345-354 (2009)
PUBMED 19308289
REMARK GeneRIF: PDCD5 contributes to maintaining a basal pool of Tip60 and
its HAT activity
REFERENCE 7 (bases 1 to 604)
AUTHORS Liu,D., Yao,H., Chen,Y., Feng,Y., Chen,Y. and Wang,J.
TITLE The N-terminal 26-residue fragment of human programmed cell death 5
protein can form a stable alpha-helix having unique electrostatic
potential character
JOURNAL Biochem. J. 392 (PT 1), 47-54 (2005)
PUBMED 16083422
REMARK GeneRIF: The effects of the secondary structure of PDCD5 on its
tertiary structure and function are reported.
REFERENCE 8 (bases 1 to 604)
AUTHORS Xu,M., Cheng,N., Gui,L., Lai,M., Wang,Y., Xia,D., Rui,M., Zhang,Y.
and Ma,D.
TITLE The 5'-upstream region of human programmed cell death 5 gene
contains a highly active TATA-less promoter that is up-regulated by
etoposide
JOURNAL Gene 329, 39-49 (2004)
PUBMED 15033527
REMARK GeneRIF: Results imply that the PDCD5 gene may be a target gene
under the control of some important apoptosis-related
transcriptional factors during the cell apoptosis.
REFERENCE 9 (bases 1 to 604)
AUTHORS Chen,Y., Sun,R., Han,W., Zhang,Y., Song,Q., Di,C. and Ma,D.
TITLE Nuclear translocation of PDCD5 (TFAR19): an early signal for
apoptosis?
JOURNAL FEBS Lett. 509 (2), 191-196 (2001)
PUBMED 11741587
REFERENCE 10 (bases 1 to 604)
AUTHORS Liu,H., Wang,Y., Zhang,Y., Song,Q., Di,C., Chen,G., Tang,J. and
Ma,D.
TITLE TFAR19, a novel apoptosis-related gene cloned from human leukemia
cell line TF-1, could enhance apoptosis of some tumor cells induced
by growth factor withdrawal
JOURNAL Biochem. Biophys. Res. Commun. 254 (1), 203-210 (1999)
PUBMED 9920759
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DN915905.1, BC015519.2 and
N40187.1.
On Dec 10, 2010 this sequence version replaced gi:21735599.
Summary: This gene encodes a protein that is upregulated during
apoptosis where it translocates rapidly from the cytoplasm to the
nucleus. The encoded protein may be an important regulator of
K(lysine) acetyltransferase 5 (a protein involved in transcription,
DNA damage response and cell cycle control) by inhibiting its
proteasome-dependent degradation. Pseudogenes have been identified
on chromosomes 5 and 12 [provided by RefSeq, Dec 2010].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: DN915905.1, DN990215.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-34 DN915905.1 1-34
35-577 BC015519.2 1-543
578-604 N40187.1 1-27 c
FEATURES Location/Qualifiers
source 1..604
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19q13.11"
gene 1..604
/gene="PDCD5"
/gene_synonym="TFAR19"
/note="programmed cell death 5"
/db_xref="GeneID:9141"
/db_xref="HGNC:8764"
/db_xref="HPRD:06843"
/db_xref="MIM:604583"
exon 1..140
/gene="PDCD5"
/gene_synonym="TFAR19"
/inference="alignment:Splign:1.39.8"
misc_feature 3
/gene="PDCD5"
/gene_synonym="TFAR19"
/note="transcription initiation site; the 5' most
initiation site has not been determined."
variation 9
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="g"
/db_xref="dbSNP:75928255"
variation 25
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="g"
/db_xref="dbSNP:11084660"
variation 52
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="t"
/db_xref="dbSNP:369864929"
variation 59
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="a"
/replace="g"
/db_xref="dbSNP:115957116"
misc_feature 63..65
/gene="PDCD5"
/gene_synonym="TFAR19"
/note="upstream in-frame stop codon"
variation 73
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="t"
/db_xref="dbSNP:377377873"
CDS 75..452
/gene="PDCD5"
/gene_synonym="TFAR19"
/note="TFAR19 novel apoptosis-related; TF1 cell
apoptosis-related gene 19; TF-1 cell apoptosis-related
protein 19"
/codon_start=1
/product="programmed cell death protein 5"
/protein_id="NP_004699.1"
/db_xref="GI:4759224"
/db_xref="CCDS:CCDS12423.1"
/db_xref="GeneID:9141"
/db_xref="HGNC:8764"
/db_xref="HPRD:06843"
/db_xref="MIM:604583"
/translation="
MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
"
misc_feature 138..410
/gene="PDCD5"
/gene_synonym="TFAR19"
/note="Double-stranded DNA-binding domain; Region:
dsDNA_bind; pfam01984"
/db_xref="CDD:202076"
misc_feature 261..263
/gene="PDCD5"
/gene_synonym="TFAR19"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (O14737.3); acetylation site"
misc_feature 429..431
/gene="PDCD5"
/gene_synonym="TFAR19"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(O14737.3); phosphorylation site"
misc_feature 429..431
/gene="PDCD5"
/gene_synonym="TFAR19"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
variation 90
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="t"
/db_xref="dbSNP:370449362"
variation 107
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="a"
/replace="g"
/db_xref="dbSNP:370056872"
variation 120
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="a"
/replace="g"
/db_xref="dbSNP:75015964"
variation 131
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="t"
/db_xref="dbSNP:200986517"
variation 138
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="g"
/db_xref="dbSNP:374870227"
exon 141..178
/gene="PDCD5"
/gene_synonym="TFAR19"
/inference="alignment:Splign:1.39.8"
variation 144
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="t"
/db_xref="dbSNP:376281754"
variation 154
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="t"
/db_xref="dbSNP:200484934"
variation 157
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="a"
/replace="c"
/db_xref="dbSNP:377327115"
exon 179..240
/gene="PDCD5"
/gene_synonym="TFAR19"
/inference="alignment:Splign:1.39.8"
variation 180
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="a"
/replace="g"
/db_xref="dbSNP:139511423"
variation 191
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="a"
/replace="g"
/db_xref="dbSNP:145038000"
variation 226
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="g"
/db_xref="dbSNP:142226357"
variation 231
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="t"
/db_xref="dbSNP:147553739"
variation 232
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="a"
/replace="g"
/db_xref="dbSNP:201933073"
variation 239
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="t"
/db_xref="dbSNP:34724018"
exon 241..332
/gene="PDCD5"
/gene_synonym="TFAR19"
/inference="alignment:Splign:1.39.8"
variation 248
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="t"
/db_xref="dbSNP:61756021"
variation 301
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="a"
/replace="g"
/db_xref="dbSNP:151218453"
STS 332..510
/gene="PDCD5"
/gene_synonym="TFAR19"
/standard_name="RH44366"
/db_xref="UniSTS:85769"
exon 333..404
/gene="PDCD5"
/gene_synonym="TFAR19"
/inference="alignment:Splign:1.39.8"
variation 362
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="a"
/replace="t"
/db_xref="dbSNP:11559150"
STS 368..496
/gene="PDCD5"
/gene_synonym="TFAR19"
/standard_name="RH41963"
/db_xref="UniSTS:15861"
variation 384
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="a"
/replace="g"
/db_xref="dbSNP:4723"
variation 385
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="a"
/replace="c"
/db_xref="dbSNP:371635048"
exon 405..604
/gene="PDCD5"
/gene_synonym="TFAR19"
/inference="alignment:Splign:1.39.8"
variation 431
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="t"
/db_xref="dbSNP:140343716"
variation 443
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="t"
/db_xref="dbSNP:200240061"
variation 449
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="t"
/db_xref="dbSNP:372958688"
variation 457
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="t"
/db_xref="dbSNP:185754385"
variation 459
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="a"
/replace="g"
/db_xref="dbSNP:375939116"
variation 473
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="a"
/replace="g"
/db_xref="dbSNP:370281361"
variation 481
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="a"
/replace="g"
/db_xref="dbSNP:369102337"
variation 482
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="t"
/db_xref="dbSNP:200907172"
variation 511
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="g"
/db_xref="dbSNP:147625080"
variation 531
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="c"
/replace="t"
/db_xref="dbSNP:139546685"
polyA_signal 553..558
/gene="PDCD5"
/gene_synonym="TFAR19"
polyA_site 572
/gene="PDCD5"
/gene_synonym="TFAR19"
variation 573
/gene="PDCD5"
/gene_synonym="TFAR19"
/replace="a"
/replace="t"
/db_xref="dbSNP:3179957"
polyA_site 577
/gene="PDCD5"
/gene_synonym="TFAR19"
ORIGIN
gcagtggtcaaggccgcgctcgcgccgaggggctgcgagagtgaccgcggctgctccagcgctgacgccgagccatggcggacgaggagcttgaggcgctgaggagacagaggctggccgagctgcaggccaaacacggggatcctggtgatgcggcccaacaggaagcaaagcacagggaagcagaaatgagaaacagtatcttagcccaagttctggatcagtcggcccgggccaggttaagtaacttagcacttgtaaagcctgaaaaaactaaagcagtagagaattaccttatacagatggcaagatatggacaactaagtgagaaggtatcagaacaaggtttaatagaaatccttaaaaaagtaagccaacaaacagaaaagacaacaacagtgaaattcaacagaagaaaagtaatggactctgatgaagatgacgattattgaactacaagtgctcacagactagaacttaacggaacaagtctaggacagaagttaagatctgattatttactttgtttattgtctatatgccttttaaaaaaataaacttgttatgcaaaataaaacatttgggtaagttgttttagtatcat
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:9141 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA
GeneID:9141 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:9141 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IMP
GeneID:9141 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:9141 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.