2024-03-29 18:51:10, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004475 2659 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens flotillin 2 (FLOT2), mRNA. ACCESSION NM_004475 VERSION NM_004475.2 GI:94538361 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2659) AUTHORS Baumann,T., Affentranger,S. and Niggli,V. TITLE Evidence for chemokine-mediated coalescence of preformed flotillin hetero-oligomers in human T-cells JOURNAL J. Biol. Chem. 287 (47), 39664-39672 (2012) PUBMED 23012365 REMARK GeneRIF: results support predominant formation of flotillin-1 and -2 hetero-oligomers in resting and chemokine-stimulated human T-cells which may importantly contribute to structuring of the uropod. REFERENCE 2 (bases 1 to 2659) AUTHORS Solis,G.P., Schrock,Y., Hulsbusch,N., Wiechers,M., Plattner,H. and Stuermer,C.A. TITLE Reggies/flotillins regulate E-cadherin-mediated cell contact formation by affecting EGFR trafficking JOURNAL Mol. Biol. Cell 23 (10), 1812-1825 (2012) PUBMED 22438585 REMARK GeneRIF: by promoting EGFR internalization, reggie-1 restricts EGFR signaling involved in E-cadherin macropinocytosis and recycling and regulate adherens junction formation REFERENCE 3 (bases 1 to 2659) AUTHORS Li,Y., Martin,B.R., Cravatt,B.F. and Hofmann,S.L. TITLE DHHC5 protein palmitoylates flotillin-2 and is rapidly degraded on induction of neuronal differentiation in cultured cells JOURNAL J. Biol. Chem. 287 (1), 523-530 (2012) PUBMED 22081607 REMARK GeneRIF: potentially relevant protein substrates of DHHC5 REFERENCE 4 (bases 1 to 2659) AUTHORS Cornfine,S., Himmel,M., Kopp,P., El Azzouzi,K., Wiesner,C., Kruger,M., Rudel,T. and Linder,S. TITLE The kinesin KIF9 and reggie/flotillin proteins regulate matrix degradation by macrophage podosomes JOURNAL Mol. Biol. Cell 22 (2), 202-215 (2011) PUBMED 21119006 REMARK GeneRIF: Reggie-1 (flotillin-2) dynamically colocalizes with KIF9 in living cells REFERENCE 5 (bases 1 to 2659) AUTHORS Ge,L., Qi,W., Wang,L.J., Miao,H.H., Qu,Y.X., Li,B.L. and Song,B.L. TITLE Flotillins play an essential role in Niemann-Pick C1-like 1-mediated cholesterol uptake JOURNAL Proc. Natl. Acad. Sci. U.S.A. 108 (2), 551-556 (2011) PUBMED 21187433 REMARK GeneRIF: flotillins have a role in NPC1L1-mediated cholesterol uptake and NPC1L1-flotillins-postive cholesterol-enriched membrane microdomains are involved in the mechanism for efficient cholesterol absorption REFERENCE 6 (bases 1 to 2659) AUTHORS Salzer,U. and Prohaska,R. TITLE Stomatin, flotillin-1, and flotillin-2 are major integral proteins of erythrocyte lipid rafts JOURNAL Blood 97 (4), 1141-1143 (2001) PUBMED 11159550 REFERENCE 7 (bases 1 to 2659) AUTHORS Hazarika,P., Dham,N., Patel,P., Cho,M., Weidner,D., Goldsmith,L. and Duvic,M. TITLE Flotillin 2 is distinct from epidermal surface antigen (ESA) and is associated with filopodia formation JOURNAL J. Cell. Biochem. 75 (1), 147-159 (1999) PUBMED 10462713 REFERENCE 8 (bases 1 to 2659) AUTHORS Volonte,D., Galbiati,F., Li,S., Nishiyama,K., Okamoto,T. and Lisanti,M.P. TITLE Flotillins/cavatellins are differentially expressed in cells and tissues and form a hetero-oligomeric complex with caveolins in vivo. Characterization and epitope-mapping of a novel flotillin-1 monoclonal antibody probe JOURNAL J. Biol. Chem. 274 (18), 12702-12709 (1999) PUBMED 10212252 REFERENCE 9 (bases 1 to 2659) AUTHORS Schroeder,W.T., Stewart-Galetka,S., Mandavilli,S., Parry,D.A., Goldsmith,L. and Duvic,M. TITLE Cloning and characterization of a novel epidermal cell surface antigen (ESA) JOURNAL J. Biol. Chem. 269 (31), 19983-19991 (1994) PUBMED 8051082 REFERENCE 10 (bases 1 to 2659) AUTHORS Schroeder,W.T., Siciliano,M.J., Stewart-Galetka,S.L. and Duvic,M. TITLE The human gene for an epidermal surface antigen (M17S1) is located at 17q11-12 JOURNAL Genomics 11 (2), 481-482 (1991) PUBMED 1769667 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA390100.1, BC003683.1, BC017292.1 and M60922.1. On May 4, 2006 this sequence version replaced gi:4758393. Summary: Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: M60922.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-88 CA390100.1 1-88 89-1104 BC003683.1 1-1016 1105-1535 BC017292.1 927-1357 1536-2631 M60922.1 1392-2487 2632-2659 BC017292.1 2454-2481 FEATURES Location/Qualifiers source 1..2659 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="17" /map="17q11-q12" gene 1..2659 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /note="flotillin 2" /db_xref="GeneID:2319" /db_xref="HGNC:3758" /db_xref="MIM:131560" exon 1..172 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /inference="alignment:Splign:1.39.8" misc_feature 40..42 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /note="upstream in-frame stop codon" CDS 124..1410 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /note="Flotillin 2 (epidermal surface antigen 1); membrane component, chromosome 17, surface marker 1 (35kD protein identified by monoclonal antibody ECS-1); membrane component chromosome 17 surface marker 1" /codon_start=1 /product="flotillin-2" /protein_id="NP_004466.2" /db_xref="GI:94538362" /db_xref="CCDS:CCDS11245.2" /db_xref="GeneID:2319" /db_xref="HGNC:3758" /db_xref="MIM:131560" /translation="
MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV
" misc_feature 139..1374 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /note="Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG2268" /db_xref="CDD:32449" misc_feature 253..636 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /note="Band_7_flotillin: a subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. These two proteins are lipid raft-associated. Individual proteins of...; Region: Band_7_flotillin; cd03399" /db_xref="CDD:48211" misc_feature <985..1173 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /note="The band 7 domain of flotillin (reggie) like proteins. This group contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this...; Region: Band_7; cl02525" /db_xref="CDD:207629" exon 173..254 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /inference="alignment:Splign:1.39.8" exon 255..345 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /inference="alignment:Splign:1.39.8" exon 346..469 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /inference="alignment:Splign:1.39.8" exon 470..588 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /inference="alignment:Splign:1.39.8" exon 589..702 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /inference="alignment:Splign:1.39.8" exon 703..822 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /inference="alignment:Splign:1.39.8" exon 823..1037 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /inference="alignment:Splign:1.39.8" exon 1038..1221 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /inference="alignment:Splign:1.39.8" exon 1222..1371 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /inference="alignment:Splign:1.39.8" exon 1372..2632 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /inference="alignment:Splign:1.39.8" variation 1418 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /replace="a" /replace="g" /db_xref="dbSNP:1060244" variation 1536 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /replace="c" /replace="t" /db_xref="dbSNP:1060247" STS 1722..2623 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /standard_name="FLOT2__6735" /db_xref="UniSTS:471437" variation 1741 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:11547605" variation 1869 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /replace="c" /replace="t" /db_xref="dbSNP:10205" STS 1876..2102 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /standard_name="D17S963" /db_xref="UniSTS:148646" STS 2345..2493 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /standard_name="RH17712" /db_xref="UniSTS:85003" variation 2360 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /replace="a" /replace="t" /db_xref="dbSNP:14117" variation 2365 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /replace="c" /replace="t" /db_xref="dbSNP:1060288" variation 2461 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:9617" variation 2473 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /replace="a" /replace="g" /db_xref="dbSNP:11547606" variation 2559 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /replace="c" /replace="t" /db_xref="dbSNP:1060340" variation 2564 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /replace="c" /replace="t" /db_xref="dbSNP:1060343" variation 2604 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" /replace="c" /replace="t" /db_xref="dbSNP:1060351" polyA_signal 2611..2616 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" polyA_site 2632 /gene="FLOT2" /gene_synonym="ECS-1; ECS1; ESA; ESA1; M17S1" ORIGIN
ggcgagcgagcgggcggccggccgctgggggtggcgggataggctgggcgcggccggcgctgcagacccgctgctgttgtccgggtctgtgcggtcccgagggccctccgtgccgccggcgccatgggcaattgccacacggtggggcccaacgaggcgctggtggtttcagggggctgttgtggttccgactataaacagtacgtgtttggcggctgggcctgggcctggtggtgtatctccgacactcagaggatttccctagagattatgacgttgcagccccgctgcgaggacgtagagacggccgagggggtagctttaactgtgacgggtgtcgcccaggtgaagatcatgacggagaaggaactcctggccgtggcttgtgagcagtttctgggtaagaatgtgcaggacatcaaaaacgtcgtcctgcagaccctggagggacatctgcgctccatcctcgggaccctgacagtggagcagatttatcaggaccgggaccagtttgccaagctggtgcgggaggtggcagcccctgatgttggccgcatgggcattgagatcctcagcttcaccatcaaggacgtgtatgacaaagtggactatctgagctccctgggcaagacgcagactgccgtggtgcagagagatgctgacattggcgtggccgaggctgaacgggacgcaggcatccgggaagctgagtgcaagaaggagatgctggatgtgaagttcatggcagacaccaagattgctgactctaagcgagccttcgagctgcaaaagtcagccttcagtgaggaggttaacatcaagacagctgaggcccagttggcctatgagctgcagggggcccgtgaacagcagaagatccggcaggaagagattgagattgaggttgtgcagcgcaagaaacagattgccgtggaggcacaggagatcctgcgtacggacaaggagctcatcgctacagtgcgccggcctgccgaggccgaggcccaccgcatccagcagattgccgagggtgaaaaggtgaagcaggtcctcttggcacaggcagaggctgagaagatccgcaaaatcggggaggcggaagcggcagtcatcgaggcgatgggcaaggcagaggctgagcggatgaagctcaaggcagaagcctaccagaaatacggggatgcagccaagatggccttggtgctagaggccctgccccagattgctgccaaaatcgctgccccacttaccaaggtcgatgagattgtggtcctcagtggagacaacagtaaggtcacatcagaagtgaaccgactgctggccgagctgcctgcctctgtgcatgccctcacaggcgtggacctgtctaagatacccctgatcaagaaggccactggtgtgcaggtgtgaggctcctgcaggcccactctcttcagcagccacccggccctccctccagcacccgttttaatcccacagaacaacgggaacgttactgactctggtgccttatctcgaagggaccagaagtgctgcgtgttcaggccatctctggctgtcttcctgtctctcctgtctgtccacctcctcctcttcctctcctttaccccactttcactgccactttcatcaggtttgtgtctcatctccctgcgtgtcttttcctttgtctgtctttttctttcccccatgcacatcatgtagattaagctgaagatgtttattacaatcactctctgtggggggtggccctgctgctcctcagaatcctggtgccttgaagttctctgtgcatctgtccatcctccctatggccctggccagagctcagcatgggcaggggttctgggtaggacggtcactgtcctctctcctggactggtcttcccagccctaaaccctgccccaggaagcccacagcctcacctgctgctgcccctctaggtctgggcagccatgacctgcagggcccagagacactgtccttcccctcatccacccaaggccccagccagcgctcataccctgtcctttctccctgaccccaagggcacagaggcaaggcctcctgtctacagcagcttcctcagtttcctactgccttaggaggcccctgcttgtgctcagggaaggcctcttcatgggcatgttcctgctggggcggtgcggtttggtcccaactctgctaagttttctgagatgagggtctagccctgttggggacagaaaagtgtgtagaccttcttcctgctagggctgcactgtcctgggtgttgggcccttctggtggacaaggctgtgccaaccctgtacagaatcgagtgctgtagcctggccagaccccagagcccttgtgccatctttcttcctggccagagtgatggggttccagccatggggaagcaacccaatcctctgtctccttgctccaatggaggcagaagagcccaggacccaagcgtcttggcaggggtgctgtgaatgtccagtggtcccagctccccaccctggccctgccccagcctgtgtagctcttcctgcatgtggatgctgcatgtctggtctggggcttggatgttgcactgccccactgcctgtcccttctggtaaaataaagaactcttaatgcccaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:2319 -> Molecular function: GO:0035255 [ionotropic glutamate receptor binding] evidence: IEA GeneID:2319 -> Biological process: GO:0007155 [cell adhesion] evidence: IEA GeneID:2319 -> Biological process: GO:0008544 [epidermis development] evidence: TAS GeneID:2319 -> Cellular component: GO:0002080 [acrosomal membrane] evidence: IEA GeneID:2319 -> Cellular component: GO:0005768 [endosome] evidence: IDA GeneID:2319 -> Cellular component: GO:0005886 [plasma membrane] evidence: NAS GeneID:2319 -> Cellular component: GO:0009986 [cell surface] evidence: IDA GeneID:2319 -> Cellular component: GO:0016600 [flotillin complex] evidence: IEA GeneID:2319 -> Cellular component: GO:0030139 [endocytic vesicle] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.