GGRNA Home | Help | Advanced search

2020-10-24 07:21:06, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_004447               4088 bp    mRNA    linear   PRI 16-JUN-2013
DEFINITION  Homo sapiens epidermal growth factor receptor pathway substrate 8
            (EPS8), mRNA.
ACCESSION   NM_004447
VERSION     NM_004447.5  GI:215272356
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4088)
  AUTHORS   Werner,A., Disanza,A., Reifenberger,N., Habeck,G., Becker,J.,
            Calabrese,M., Urlaub,H., Lorenz,H., Schulman,B., Scita,G. and
            Melchior,F.
  TITLE     SCFFbxw5 mediates transient degradation of actin remodeller Eps8 to
            allow proper mitotic progression
  JOURNAL   Nat. Cell Biol. 15 (2), 179-188 (2013)
   PUBMED   23314863
  REMARK    GeneRIF: Identify Fbxw5-driven fluctuation of Eps8 levels as an
            important mechanism that contributes to cell-shape changes during
            entry into-and exit from-mitosis.
REFERENCE   2  (bases 1 to 4088)
  AUTHORS   Ding,X., Zhou,F., Wang,F., Yang,Z., Zhou,C., Zhou,J., Zhang,B.,
            Yang,J., Wang,G., Wei,Z., Hu,X., Xiang,S. and Zhang,J.
  TITLE     Eps8 promotes cellular growth of human malignant gliomas
  JOURNAL   Oncol. Rep. 29 (2), 697-703 (2013)
   PUBMED   23229386
  REMARK    GeneRIF: We found that Eps8 mediates cell proliferation and
            survival of glioma cells, at least in part, by affecting
            phosphorylated ERK and Akt/beta-catenin activities.
REFERENCE   3  (bases 1 to 4088)
  AUTHORS   Cattaneo,M.G., Cappellini,E. and Vicentini,L.M.
  TITLE     Silencing of Eps8 blocks migration and invasion in human
            glioblastoma cell lines
  JOURNAL   Exp. Cell Res. 318 (15), 1901-1912 (2012)
   PUBMED   22683923
  REMARK    GeneRIF: silencing of the protein by siRNA abrogated the migratory
            and invasive capacity of three different glioblastoma cell lines
            both in 2-dimensional and 3-dimensional in vitro assays.
REFERENCE   4  (bases 1 to 4088)
  AUTHORS   Abdel-Rahman,W.M., Ruosaari,S., Knuutila,S. and Peltomaki,P.
  TITLE     Differential roles of EPS8 in carcinogenesis: loss of protein
            expression in a subset of colorectal carcinoma and adenoma
  JOURNAL   World J. Gastroenterol. 18 (29), 3896-3903 (2012)
   PUBMED   22876043
  REMARK    GeneRIF: The loss of EPS8 expression in colorectal adenomas and
            carcinomas suggests that down regulation of this gene contributes
            to the development of a subset of colorectal cancers.
REFERENCE   5  (bases 1 to 4088)
  AUTHORS   Chen,Y.J., Hsieh,M.Y., Chang,M.Y., Chen,H.C., Jan,M.S., Maa,M.C.
            and Leu,T.H.
  TITLE     Eps8 protein facilitates phagocytosis by increasing TLR4-MyD88
            protein interaction in lipopolysaccharide-stimulated macrophages
  JOURNAL   J. Biol. Chem. 287 (22), 18806-18819 (2012)
   PUBMED   22493489
  REMARK    GeneRIF: Eps8 is a key regulator of the LPS-stimulated TLR4-MyD88
            interaction and contributes to macrophage phagocytosis
REFERENCE   6  (bases 1 to 4088)
  AUTHORS   Avantaggiato,V., Torino,A., Wong,W.T., Di Fiore,P.P. and Simeone,A.
  TITLE     Expression of the receptor tyrosine kinase substrate genes eps8 and
            eps15 during mouse development
  JOURNAL   Oncogene 11 (6), 1191-1198 (1995)
   PUBMED   7566980
REFERENCE   7  (bases 1 to 4088)
  AUTHORS   Matoskova,B., Wong,W.T., Salcini,A.E., Pelicci,P.G. and Di
            Fiore,P.P.
  TITLE     Constitutive phosphorylation of eps8 in tumor cell lines: relevance
            to malignant transformation
  JOURNAL   Mol. Cell. Biol. 15 (7), 3805-3812 (1995)
   PUBMED   7791787
REFERENCE   8  (bases 1 to 4088)
  AUTHORS   Karlsson,T., Songyang,Z., Landgren,E., Lavergne,C., Di Fiore,P.P.,
            Anafi,M., Pawson,T., Cantley,L.C., Claesson-Welsh,L. and Welsh,M.
  TITLE     Molecular interactions of the Src homology 2 domain protein Shb
            with phosphotyrosine residues, tyrosine kinase receptors and Src
            homology 3 domain proteins
  JOURNAL   Oncogene 10 (8), 1475-1483 (1995)
   PUBMED   7537362
REFERENCE   9  (bases 1 to 4088)
  AUTHORS   Castagnino,P., Biesova,Z., Wong,W.T., Fazioli,F., Gill,G.N. and Di
            Fiore,P.P.
  TITLE     Direct binding of eps8 to the juxtamembrane domain of EGFR is
            phosphotyrosine- and SH2-independent
  JOURNAL   Oncogene 10 (4), 723-729 (1995)
   PUBMED   7532293
REFERENCE   10 (bases 1 to 4088)
  AUTHORS   Cardwell,C.
  TITLE     Student or worker? International Meeting of Student Nurses
            (European Group)
  JOURNAL   Nurs Mirror Midwives J 143 (19), 38 (1976)
   PUBMED   1049958
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AK304860.1, BC030010.2 and
            AI377466.1.
            On Nov 27, 2008 this sequence version replaced gi:56682952.
            
            Summary: This gene encodes a member of the EPS8 family. This
            protein contains one PH domain and one SH3 domain. It functions as
            part of the EGFR pathway, though its exact role has not been
            determined. Highly similar proteins in other organisms are involved
            in the transduction of signals from Ras to Rac and growth
            factor-mediated actin remodeling. Alternate transcriptional splice
            variants of this gene have been observed but have not been
            thoroughly characterized. [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC030010.2, U12535.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025081, ERS025082 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-2463              AK304860.1         1-2463
            2464-4062           BC030010.2         2276-3874
            4063-4088           AI377466.1         1-26                c
FEATURES             Location/Qualifiers
     source          1..4088
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="12"
                     /map="12p12.3"
     gene            1..4088
                     /gene="EPS8"
                     /note="epidermal growth factor receptor pathway substrate
                     8"
                     /db_xref="GeneID:2059"
                     /db_xref="HGNC:3420"
                     /db_xref="MIM:600206"
     exon            1..416
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     exon            417..496
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     CDS             438..2906
                     /gene="EPS8"
                     /codon_start=1
                     /product="epidermal growth factor receptor kinase
                     substrate 8"
                     /protein_id="NP_004438.3"
                     /db_xref="GI:56682953"
                     /db_xref="CCDS:CCDS31753.1"
                     /db_xref="GeneID:2059"
                     /db_xref="HGNC:3420"
                     /db_xref="MIM:600206"
                     /translation="
MNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKNKKGKRKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFNLLAKLKSHIQNPSAADLVHFLFTPLNMVVQATGGPELASSVLSPLLNKDTIDFLNYTVNGDERQLWMSLGGTWMKARAEWPKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADGYAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADPPYTHTIQKQRMEYGPRPADTPPAPSPPPTPAPVPVPLPPSTPAPVPVSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIHRLTIGRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQITVQKAALEDSSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH
"
     misc_feature    order(624..647,744..764,771..791,837..851,879..893,
                     924..938)
                     /gene="EPS8"
                     /note="PH-like core; other site"
                     /db_xref="CDD:176275"
     misc_feature    627..1019
                     /gene="EPS8"
                     /note="Phosphotyrosine-binding domain; Region: PTB;
                     pfam08416"
                     /db_xref="CDD:203936"
     misc_feature    1863..1865
                     /gene="EPS8"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q12929.1); phosphorylation site"
     misc_feature    2010..2012
                     /gene="EPS8"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    2040..2201
                     /gene="EPS8"
                     /note="Src Homology 3 domain of Epidermal growth factor
                     receptor kinase substrate 8 and similar proteins; Region:
                     SH3_Eps8; cd11764"
                     /db_xref="CDD:212698"
     misc_feature    order(2040..2057,2061..2063,2070..2072,2079..2087,
                     2106..2123,2127..2153,2166..2177,2187..2201)
                     /gene="EPS8"
                     /note="swapped dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212698"
     misc_feature    order(2061..2063,2073..2081,2130..2138,2142..2144,
                     2169..2174,2178..2189)
                     /gene="EPS8"
                     /note="peptide ligand binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:212698"
     misc_feature    2382..2903
                     /gene="EPS8"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q12929.1);
                     Region: Effector region (By similarity)"
     misc_feature    2421..2423
                     /gene="EPS8"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    2427..2429
                     /gene="EPS8"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    2475..2531
                     /gene="EPS8"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q12929.1);
                     Region: Amphipathic helix (By similarity)"
     misc_feature    2589..2651
                     /gene="EPS8"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q12929.1);
                     Region: Helix bundle 1 (By similarity)"
     misc_feature    2595..2789
                     /gene="EPS8"
                     /note="SAM domain of EPS8-like subfamily; Region:
                     SAM_EPS8-like; cd09540"
                     /db_xref="CDD:188939"
     misc_feature    2691..2708
                     /gene="EPS8"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q12929.1);
                     Region: Helix bundle 2 (By similarity)"
     misc_feature    2721..2738
                     /gene="EPS8"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q12929.1);
                     Region: Helix bundle 3 (By similarity)"
     misc_feature    2733..2792
                     /gene="EPS8"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q12929.1);
                     Region: Helix bundle 4 (By similarity)"
     misc_feature    2757..2759
                     /gene="EPS8"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    2868..2870
                     /gene="EPS8"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    2880..2882
                     /gene="EPS8"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     exon            497..573
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     exon            574..641
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     variation       634
                     /gene="EPS8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:77383735"
     exon            642..803
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     variation       650
                     /gene="EPS8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2230644"
     exon            804..953
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     exon            954..1036
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     variation       954
                     /gene="EPS8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:78872942"
     exon            1037..1173
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     exon            1174..1247
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     exon            1248..1374
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     variation       1312
                     /gene="EPS8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:76714646"
     exon            1375..1463
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     variation       1377
                     /gene="EPS8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79631530"
     variation       1423
                     /gene="EPS8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:79739141"
     exon            1464..1538
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     variation       1520
                     /gene="EPS8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76040570"
     exon            1539..1687
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     exon            1688..1871
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     exon            1872..2005
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     variation       1895
                     /gene="EPS8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201971316"
     variation       1919
                     /gene="EPS8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:75560906"
     variation       1992
                     /gene="EPS8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:76688635"
     exon            2006..2114
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     variation       2090
                     /gene="EPS8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75362705"
     exon            2115..2258
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     exon            2259..2481
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     variation       2275
                     /gene="EPS8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:74888964"
     exon            2482..2662
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     variation       2550
                     /gene="EPS8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:78763451"
     exon            2663..2792
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     variation       2667
                     /gene="EPS8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:77967764"
     variation       2789
                     /gene="EPS8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1126786"
     exon            2793..4083
                     /gene="EPS8"
                     /inference="alignment:Splign:1.39.8"
     variation       2853
                     /gene="EPS8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1802658"
     variation       2907
                     /gene="EPS8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:75484324"
     variation       2920
                     /gene="EPS8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:74652091"
     STS             3295..3628
                     /gene="EPS8"
                     /standard_name="SHGC-12935"
                     /db_xref="UniSTS:5607"
     STS             3662..3836
                     /gene="EPS8"
                     /standard_name="RH70563"
                     /db_xref="UniSTS:38357"
     STS             3726..4029
                     /gene="EPS8"
                     /standard_name="SHGC-132117"
                     /db_xref="UniSTS:170656"
     variation       3737
                     /gene="EPS8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:8664"
     polyA_signal    4037..4042
                     /gene="EPS8"
     polyA_signal    4061..4066
                     /gene="EPS8"
     polyA_site      4083
                     /gene="EPS8"
ORIGIN      
cacttcgcctcaagcgctggagtcgaccagaactctgcggctcggctgccggcaagacccggatagcggatttcgctcctggctgcggggcgcgcactcgcccgcccgcccgctcgctcgttcctcgcgcgggcactgggcatgcgcggcgcgcggttggcactggctgcgagcgggcgggcggctccagacttcacaggcagcagctagcgaggcggtctcgcccggcgcgaggccggcgctgtgctcgcctcggagatcgctgctctttagctgggtgcagaaggcggctccgcggctcgcggacgactggctgggcgcgaatcagattggggggctttctcccggtcccctcccacctcgtctgggctcgcggcgtctccggggaaagccgtggccccgagggcggatccgagaacacacaagtgaaagacacaatgaatggtcatatttctaatcatcccagtagttttggaatgtacccatctcagatgaatggctacggatcatcacctaccttttcccagacggacagagaacatggttcaaaaacaagtgcaaaggccctttatgaacaaaggaagaattatgcacgggacagtgtcagcagtgtgtcagatatatctcaataccgtgttgaacacttgactacctttgtcctggatcggaaagatgctatgatcactgttgatgatggaataaggaaattgaaattgcttgatgccaagggcaaagtgtggactcaagatatgattcttcaagtggatgacagagctgtgagcctgattgatttagaatcaaagaatgaactggagaattttcctttaaacacaatccagcactgccaagctgtgatgcattcatgcagctatgattcagttcttgcactggtgtgcaaagagccaacccagaacaagccagatcttcatctcttccagtgtgatgaggttaaggcaaacctaattagtgaagatattgaaagtgcaatcagtgacagtaaaggagggaaacagaagaggcggcccgacgccctgaggatgatttccaatgcagaccctagtataccgcctccacccagagctcctgcccctgcgccccctgggaccgtcacccaggtggatgttagaagtcgagtggcagcctggtctgcatgggcagccgaccaaggggactttgagaaaccaaggcagtatcatgagcaggaagaaacacctgagatgatggcagcccgcattgacagagatgtgcaaatcttaaaccacattttggatgacattgaattttttatcacaaaactccaaaaagcagcagaagcattttctgagctttctaaaaggaagaaaaacaagaaaggtaaaaggaaaggaccaggagagggtgttttaacgctgcgggcaaaacctccacctcctgatgaatttcttgactgtttccaaaagtttaaacacggatttaaccttctggccaaactgaagtctcatattcagaatcctagtgctgcagatttggttcactttttgtttactccattaaatatggtggtgcaggcaacaggaggtcctgaactagccagttcagtacttagtcccctattgaataaggacacaattgatttcttaaattatactgtcaatggtgatgaacggcagctgtggatgtcattgggaggaacttggatgaaagccagagcagagtggccaaaagaacagtttattccaccatatgttccacgattccgcaatggctgggagcccccaatgctgaactttatgggagccacaatggaacaagatctttatcaactggcagaatctgtggcaaatgtagcagaacatcagcgcaaacaggaaataaaaagattatccacagagcattccagtgtatcagagtatcatccagccgatggctatgcgttcagtagcaacatttacacaagaggatcccacctggaccaaggggaagctgctgttgcttttaagccaacttctaatcgccatatagatagaaattatgaaccactcaaaacacaacccaagaaatatgccaaatccaagtatgactttgtagcaaggaacaacagtgagctctcggttctaaaggatgatattttagagatacttgatgatcggaagcaatggtggaaagttcgaaatgcaagtggagactctggatttgtgccaaataacattttggatattgtgagacctccagaatctggattggggcgtgctgatccaccttatactcatactatacagaaacaaaggatggagtatggcccaagaccagctgatactccccctgctccatcacctcctccaacaccagctcctgttcctgttccccttcccccttccactccagcacctgttcctgtgtcaaaggtcccagcaaatataacacgtcaaaacagcagctccagtgacagtggtggcagtatcgtgcgagacagccagagacacaaacaacttccggtggaccgaaggaaatctcagatggaggaagtgcaagatgaactcatccacagactgaccattggtcggagtgccgctcagaagaaattccatgtgccacggcagaacgtgccagttatcaatatcacttacgactccacaccagaggatgtgaagacgtggttacagtcaaagggattcaaccctgtgactgtcaatagtcttggagtattaaatggtgcacaacttttctctctcaataaggatgaactgaggacagtctgccctgaaggggcgagagtctatagccaaatcactgtacaaaaagctgcattggaggatagcagtggcagctccgagttacaagaaattatgagaagacgacaggaaaaaatcagtgctgccgctagtgattcaggagtggaatcttttgatgaaggaagcagtcactaatttgtttgtttgtatttaaactccattgtttttggcattattccaacatgctttgttttaagaagccttgaagggaatgtcagattcatttttcttgatgtaatttatcaccataaaaaaaaaacccatgcaaacctgagtgagcacaggatttgcttctaggcccattatttttattaaaactgaaaaaatttaaactgaattttttgaccttggaaaatatttttcttactttaccaaggtgaagtttccttaattagactaattattttatccccatcccagggtataaacaggaattgttttgatagtggtggagttattcactgcaacaaagcaacaatgttgtccatgattcaaaatctaagcagtttcgattttgcctgtgaatatggtgtctgtcattcagggcatagctcactgtaggctagcctctgcttacttaagtctcttctctgacatactcaatggaagaatatttagatttatttaaagttcttaatgccaacagtttaaaaaaaaattaaaacatttgaatgaactgtaaagtacagccataccttggacatgcaaatataaatctatggagcattctcaagacagtttgtcatggctctgttgattgcaactccttgtatagcttgtattttgatttagtttatattctgcttattatgtatactgtgttcttatatatgagaaagcacaaatgcgaaagaggtcatgtcttctcaaaatctagcaaaggaagtagtctgcattggtgtgcattacagtattttgcttaatgaaagcctcagttctgaatgttgatatgagtagttaaaaggaagtggggccattttatgtgtttatctgtgtcaagtatttctggtaataagaagcacttaatttacacatattttaatcctgtgaaagattccacatagagaaaagaaagatacctaaccttcaacaaatgttatttttggaaacacaatttttgtcattaaatgttatattatttcacatatataaaacagatgttatgtaagaatgttgtatattttaacataaatcatttagagaaattatctagattcattaattttcatagtgcctttttcacatgagtcagctggaaagtctgcaataaacagtatttgctgtctgttaataaatggtttctgtctcattaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:2059 -> Molecular function: GO:0003779 [actin binding] evidence: ISS
            GeneID:2059 -> Molecular function: GO:0005070 [SH3/SH2 adaptor activity] evidence: TAS
            GeneID:2059 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:2059 -> Molecular function: GO:0048365 [Rac GTPase binding] evidence: ISS
            GeneID:2059 -> Biological process: GO:0007165 [signal transduction] evidence: TAS
            GeneID:2059 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS
            GeneID:2059 -> Biological process: GO:0008283 [cell proliferation] evidence: TAS
            GeneID:2059 -> Biological process: GO:0008344 [adult locomotory behavior] evidence: IEA
            GeneID:2059 -> Biological process: GO:0008360 [regulation of cell shape] evidence: ISS
            GeneID:2059 -> Biological process: GO:0010458 [exit from mitosis] evidence: ISS
            GeneID:2059 -> Biological process: GO:0016601 [Rac protein signal transduction] evidence: ISS
            GeneID:2059 -> Biological process: GO:0030832 [regulation of actin filament length] evidence: ISS
            GeneID:2059 -> Biological process: GO:0031532 [actin cytoskeleton reorganization] evidence: IEA
            GeneID:2059 -> Biological process: GO:0036336 [dendritic cell migration] evidence: ISS
            GeneID:2059 -> Biological process: GO:0048149 [behavioral response to ethanol] evidence: IEA
            GeneID:2059 -> Biological process: GO:0051016 [barbed-end actin filament capping] evidence: ISS
            GeneID:2059 -> Biological process: GO:0051017 [actin filament bundle assembly] evidence: ISS
            GeneID:2059 -> Biological process: GO:0051764 [actin crosslink formation] evidence: ISS
            GeneID:2059 -> Biological process: GO:0070358 [actin polymerization-dependent cell motility] evidence: ISS
            GeneID:2059 -> Cellular component: GO:0005938 [cell cortex] evidence: ISS
            GeneID:2059 -> Cellular component: GO:0014069 [postsynaptic density] evidence: IEA
            GeneID:2059 -> Cellular component: GO:0017146 [N-methyl-D-aspartate selective glutamate receptor complex] evidence: IEA
            GeneID:2059 -> Cellular component: GO:0030426 [growth cone] evidence: IEA
            GeneID:2059 -> Cellular component: GO:0032420 [stereocilium] evidence: ISS
            GeneID:2059 -> Cellular component: GO:0032587 [ruffle membrane] evidence: ISS
            GeneID:2059 -> Cellular component: GO:0070062 [extracellular vesicular exosome] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.