GGRNA Home | Help | Advanced search

2024-04-18 10:39:09, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_004378                782 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens cellular retinoic acid binding protein 1 (CRABP1),
            mRNA.
ACCESSION   NM_004378
VERSION     NM_004378.2  GI:193083132
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 782)
  AUTHORS   Chile,T., Correa-Giannella,M.L., Fortes,M.A., Bronstein,M.D.,
            Cunha-Neto,M.B., Giannella-Neto,D. and Giorgi,R.R.
  TITLE     Expression of CRABP1, GRP, and RERG mRNA in clinically
            non-functioning and functioning pituitary adenomas
  JOURNAL   J. Endocrinol. Invest. 34 (8), E214-E218 (2011)
   PUBMED   21270509
  REMARK    GeneRIF: Results describe the mRNA expression of CRABP1, RERG, and
            GRP in pituitary adenomas.
REFERENCE   2  (bases 1 to 782)
  AUTHORS   Oshikawa,M., Tsutsui,C., Ikegami,T., Fuchida,Y., Matsubara,M.,
            Toyama,S., Usami,R., Ohtoko,K. and Kato,S.
  TITLE     Full-length transcriptome analysis of human retina-derived cell
            lines ARPE-19 and Y79 using the vector-capping method
  JOURNAL   Invest. Ophthalmol. Vis. Sci. 52 (9), 6662-6670 (2011)
   PUBMED   21697133
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 782)
  AUTHORS   Miyake,T., Ueda,Y., Matsuzaki,S., Miyatake,T., Yoshino,K.,
            Fujita,M., Nomura,T., Enomoto,T. and Kimura,T.
  TITLE     CRABP1-reduced expression is associated with poorer prognosis in
            serous and clear cell ovarian adenocarcinoma
  JOURNAL   J. Cancer Res. Clin. Oncol. 137 (4), 715-722 (2011)
   PUBMED   20571827
  REMARK    GeneRIF: reduced expression of CRABP1 has a potential as a
            prognostic marker for serous adenocarcinoma which is the most
            frequent histological ovarian tumor type and also for clear cell
            carcinoma that often exhibits chemo-resistance.
REFERENCE   4  (bases 1 to 782)
  AUTHORS   Roder,C., Peters,V., Kasuya,H., Nishizawa,T., Takehara,Y., Berg,D.,
            Schulte,C., Khan,N., Tatagiba,M. and Krischek,B.
  TITLE     Polymorphisms in TGFB1 and PDGFRB are associated with Moyamoya
            disease in European patients
  JOURNAL   Acta Neurochir (Wien) 152 (12), 2153-2160 (2010)
   PUBMED   20571834
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   5  (bases 1 to 782)
  AUTHORS   Jugessur,A., Shi,M., Gjessing,H.K., Lie,R.T., Wilcox,A.J.,
            Weinberg,C.R., Christensen,K., Boyles,A.L., Daack-Hirsch,S.,
            Nguyen,T.T., Christiansen,L., Lidral,A.C. and Murray,J.C.
  TITLE     Maternal genes and facial clefts in offspring: a comprehensive
            search for genetic associations in two population-based cleft
            studies from Scandinavia
  JOURNAL   PLoS ONE 5 (7), E11493 (2010)
   PUBMED   20634891
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 782)
  AUTHORS   Flagiello,D., Apiou,F., Gibaud,A., Poupon,M.F., Dutrillaux,B. and
            Malfoy,B.
  TITLE     Assignment of the genes for cellular retinoic acid binding protein
            1 (CRABP1) and 2 (CRABP2) to human chromosome band 15q24 and
            1q21.3, respectively, by in situ hybridization
  JOURNAL   Cytogenet. Cell Genet. 76 (1-2), 17-18 (1997)
   PUBMED   9154115
REFERENCE   7  (bases 1 to 782)
  AUTHORS   Liu,W., Hellman,P., Li,Q., Yu,W.R., Juhlin,C., Nordlinder,H.,
            Rollman,O., Akerstrom,G., Torma,H. and Melhus,H.
  TITLE     Biosynthesis and function of all-trans- and 9-cis-retinoic acid in
            parathyroid cells
  JOURNAL   Biochem. Biophys. Res. Commun. 229 (3), 922-929 (1996)
   PUBMED   9005841
REFERENCE   8  (bases 1 to 782)
  AUTHORS   Eller,M.S., Oleksiak,M.F., McQuaid,T.J., McAfee,S.G. and
            Gilchrest,B.A.
  TITLE     The molecular cloning and expression of two CRABP cDNAs from human
            skin
  JOURNAL   Exp. Cell Res. 198 (2), 328-336 (1992)
   PUBMED   1309505
REFERENCE   9  (bases 1 to 782)
  AUTHORS   Astrom,A., Tavakkol,A., Pettersson,U., Cromie,M., Elder,J.T. and
            Voorhees,J.J.
  TITLE     Molecular cloning of two human cellular retinoic acid-binding
            proteins (CRABP). Retinoic acid-induced expression of CRABP-II but
            not CRABP-I in adult human skin in vivo and in skin fibroblasts in
            vitro
  JOURNAL   J. Biol. Chem. 266 (26), 17662-17666 (1991)
   PUBMED   1654334
REFERENCE   10 (bases 1 to 782)
  AUTHORS   Ong,D.E.
  TITLE     Cellular retinoid-binding proteins
  JOURNAL   Arch Dermatol 123 (12), 1693-1695A (1987)
   PUBMED   2825608
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AU132726.1, BC022069.1 and
            AI863257.1.
            On Jun 27, 2008 this sequence version replaced gi:4758051.
            
            Summary: This gene encodes a specific binding protein for a vitamin
            A family member and is thought to play an important role in
            retinoic acid-mediated differentiation and proliferation processes.
            It is structurally similar to the cellular retinol-binding
            proteins, but binds only retinoic acid at specific sites within the
            nucleus, which may contribute to vitamin A-directed differentiation
            in epithelial tissue. [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AU132726.1, BU558224.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025082, ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-164               AU132726.1         1-164
            165-438             BC022069.1         141-414
            439-782             AI863257.1         1-344               c
FEATURES             Location/Qualifiers
     source          1..782
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="15"
                     /map="15q24"
     gene            1..782
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /note="cellular retinoic acid binding protein 1"
                     /db_xref="GeneID:1381"
                     /db_xref="HGNC:2338"
                     /db_xref="HPRD:07520"
                     /db_xref="MIM:180230"
     exon            1..175
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /inference="alignment:Splign:1.39.8"
     variation       14
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:76956384"
     variation       90
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370214828"
     variation       98
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376583344"
     CDS             106..519
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /note="cellular retinoic acid-binding protein I"
                     /codon_start=1
                     /product="cellular retinoic acid-binding protein 1"
                     /protein_id="NP_004369.1"
                     /db_xref="GI:4758052"
                     /db_xref="CCDS:CCDS10301.1"
                     /db_xref="GeneID:1381"
                     /db_xref="HGNC:2338"
                     /db_xref="HPRD:07520"
                     /db_xref="MIM:180230"
                     /translation="
MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE
"
     misc_feature    118..516
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /note="Lipocalin / cytosolic fatty-acid binding protein
                     family; Region: Lipocalin; pfam00061"
                     /db_xref="CDD:215686"
     misc_feature    166..198
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P29762.2);
                     Region: Nuclear localization signal (By similarity)"
     misc_feature    499..507
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P29762.2);
                     Region: Retinoic acid binding (By similarity)"
     variation       117
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143159972"
     variation       165
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1127472"
     exon            176..354
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /inference="alignment:Splign:1.39.8"
     STS             182..354
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /standard_name="Crabp1"
                     /db_xref="UniSTS:141393"
     variation       210
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:151297065"
     variation       238
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377695187"
     variation       276
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:144623327"
     STS             297..448
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /standard_name="Crabp1"
                     /db_xref="UniSTS:186507"
     variation       309
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139444854"
     variation       350
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201917878"
     variation       354
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372532542"
     exon            355..468
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /inference="alignment:Splign:1.39.8"
     variation       359
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372825750"
     variation       364
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370616671"
     variation       389
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:374536418"
     variation       403
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146054360"
     variation       415
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143976499"
     variation       417
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146438158"
     variation       440
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:17851967"
     variation       445
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:139860189"
     exon            469..772
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /inference="alignment:Splign:1.39.8"
     variation       471
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201961718"
     variation       477
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201099878"
     variation       480
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369611524"
     variation       485
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373989417"
     variation       487
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185656115"
     STS             489..742
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /standard_name="WI-20012"
                     /db_xref="UniSTS:43715"
     variation       516
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:78554547"
     STS             523..760
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /standard_name="D15S1227"
                     /db_xref="UniSTS:26305"
     STS             536..742
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /standard_name="STS-W95693"
                     /db_xref="UniSTS:43714"
     variation       597
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188311015"
     variation       603
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:180673426"
     variation       627
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373890664"
     variation       704
                     /gene="CRABP1"
                     /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140883903"
ORIGIN      
aaggcgcgcagcgctgggcgcaaagcgccagtctccgccttgcgagctcagagtgtgcccgctgcgccgccgctgtccgtacctgccgccgccgccaccgccaccatgcccaacttcgccggcacctggaagatgcgcagcagcgagaatttcgacgagctgctcaaggcactgggtgtgaacgccatgctgaggaaagtggccgtagcggctgcgtccaagccgcacgtggagatccgccaggacggggatcagttctacatcaagacatccaccacggtgcgcaccactgagatcaacttcaaggtcggagaaggctttgaggaggagaccgtggacggacgcaagtgcaggagtttagccacttgggagaatgagaacaagatccactgcacgcaaactcttcttgaaggggacggccccaaaacctactggacccgtgagctggccaacgatgaacttatcctgacgtttggcgccgatgacgtggtctgcaccagaatttatgtccgagagtgaaggcagctggcttgctcctactttcaggaagggatgcaggctcccctgaggaatatgtcatagttctgagctgccagtggaccgcccttttcccctaccaatattaggtgatcccgttttccccatgacaatgttgtagtgtcccccacccccaccccccaggccttggtgcctcttgtatccctagtgctccatagtttggcatttgcacggtttcgaagtcattaaactggttagacgtgtctcaacctttaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:1381 -> Molecular function: GO:0001972 [retinoic acid binding] evidence: IEA
            GeneID:1381 -> Molecular function: GO:0005215 [transporter activity] evidence: IEA
            GeneID:1381 -> Molecular function: GO:0005501 [retinoid binding] evidence: TAS
            GeneID:1381 -> Molecular function: GO:0016918 [retinal binding] evidence: IEA
            GeneID:1381 -> Molecular function: GO:0019841 [retinol binding] evidence: IEA
            GeneID:1381 -> Biological process: GO:0007165 [signal transduction] evidence: TAS
            GeneID:1381 -> Biological process: GO:0007275 [multicellular organismal development] evidence: TAS
            GeneID:1381 -> Cellular component: GO:0005829 [cytosol] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.