2024-04-26 14:56:48, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004378 782 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens cellular retinoic acid binding protein 1 (CRABP1), mRNA. ACCESSION NM_004378 VERSION NM_004378.2 GI:193083132 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 782) AUTHORS Chile,T., Correa-Giannella,M.L., Fortes,M.A., Bronstein,M.D., Cunha-Neto,M.B., Giannella-Neto,D. and Giorgi,R.R. TITLE Expression of CRABP1, GRP, and RERG mRNA in clinically non-functioning and functioning pituitary adenomas JOURNAL J. Endocrinol. Invest. 34 (8), E214-E218 (2011) PUBMED 21270509 REMARK GeneRIF: Results describe the mRNA expression of CRABP1, RERG, and GRP in pituitary adenomas. REFERENCE 2 (bases 1 to 782) AUTHORS Oshikawa,M., Tsutsui,C., Ikegami,T., Fuchida,Y., Matsubara,M., Toyama,S., Usami,R., Ohtoko,K. and Kato,S. TITLE Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method JOURNAL Invest. Ophthalmol. Vis. Sci. 52 (9), 6662-6670 (2011) PUBMED 21697133 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 782) AUTHORS Miyake,T., Ueda,Y., Matsuzaki,S., Miyatake,T., Yoshino,K., Fujita,M., Nomura,T., Enomoto,T. and Kimura,T. TITLE CRABP1-reduced expression is associated with poorer prognosis in serous and clear cell ovarian adenocarcinoma JOURNAL J. Cancer Res. Clin. Oncol. 137 (4), 715-722 (2011) PUBMED 20571827 REMARK GeneRIF: reduced expression of CRABP1 has a potential as a prognostic marker for serous adenocarcinoma which is the most frequent histological ovarian tumor type and also for clear cell carcinoma that often exhibits chemo-resistance. REFERENCE 4 (bases 1 to 782) AUTHORS Roder,C., Peters,V., Kasuya,H., Nishizawa,T., Takehara,Y., Berg,D., Schulte,C., Khan,N., Tatagiba,M. and Krischek,B. TITLE Polymorphisms in TGFB1 and PDGFRB are associated with Moyamoya disease in European patients JOURNAL Acta Neurochir (Wien) 152 (12), 2153-2160 (2010) PUBMED 20571834 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 5 (bases 1 to 782) AUTHORS Jugessur,A., Shi,M., Gjessing,H.K., Lie,R.T., Wilcox,A.J., Weinberg,C.R., Christensen,K., Boyles,A.L., Daack-Hirsch,S., Nguyen,T.T., Christiansen,L., Lidral,A.C. and Murray,J.C. TITLE Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia JOURNAL PLoS ONE 5 (7), E11493 (2010) PUBMED 20634891 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) Publication Status: Online-Only REFERENCE 6 (bases 1 to 782) AUTHORS Flagiello,D., Apiou,F., Gibaud,A., Poupon,M.F., Dutrillaux,B. and Malfoy,B. TITLE Assignment of the genes for cellular retinoic acid binding protein 1 (CRABP1) and 2 (CRABP2) to human chromosome band 15q24 and 1q21.3, respectively, by in situ hybridization JOURNAL Cytogenet. Cell Genet. 76 (1-2), 17-18 (1997) PUBMED 9154115 REFERENCE 7 (bases 1 to 782) AUTHORS Liu,W., Hellman,P., Li,Q., Yu,W.R., Juhlin,C., Nordlinder,H., Rollman,O., Akerstrom,G., Torma,H. and Melhus,H. TITLE Biosynthesis and function of all-trans- and 9-cis-retinoic acid in parathyroid cells JOURNAL Biochem. Biophys. Res. Commun. 229 (3), 922-929 (1996) PUBMED 9005841 REFERENCE 8 (bases 1 to 782) AUTHORS Eller,M.S., Oleksiak,M.F., McQuaid,T.J., McAfee,S.G. and Gilchrest,B.A. TITLE The molecular cloning and expression of two CRABP cDNAs from human skin JOURNAL Exp. Cell Res. 198 (2), 328-336 (1992) PUBMED 1309505 REFERENCE 9 (bases 1 to 782) AUTHORS Astrom,A., Tavakkol,A., Pettersson,U., Cromie,M., Elder,J.T. and Voorhees,J.J. TITLE Molecular cloning of two human cellular retinoic acid-binding proteins (CRABP). Retinoic acid-induced expression of CRABP-II but not CRABP-I in adult human skin in vivo and in skin fibroblasts in vitro JOURNAL J. Biol. Chem. 266 (26), 17662-17666 (1991) PUBMED 1654334 REFERENCE 10 (bases 1 to 782) AUTHORS Ong,D.E. TITLE Cellular retinoid-binding proteins JOURNAL Arch Dermatol 123 (12), 1693-1695A (1987) PUBMED 2825608 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AU132726.1, BC022069.1 and AI863257.1. On Jun 27, 2008 this sequence version replaced gi:4758051. Summary: This gene encodes a specific binding protein for a vitamin A family member and is thought to play an important role in retinoic acid-mediated differentiation and proliferation processes. It is structurally similar to the cellular retinol-binding proteins, but binds only retinoic acid at specific sites within the nucleus, which may contribute to vitamin A-directed differentiation in epithelial tissue. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AU132726.1, BU558224.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025082, ERS025084 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-164 AU132726.1 1-164 165-438 BC022069.1 141-414 439-782 AI863257.1 1-344 c FEATURES Location/Qualifiers source 1..782 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="15" /map="15q24" gene 1..782 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /note="cellular retinoic acid binding protein 1" /db_xref="GeneID:1381" /db_xref="HGNC:2338" /db_xref="HPRD:07520" /db_xref="MIM:180230" exon 1..175 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /inference="alignment:Splign:1.39.8" variation 14 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="t" /db_xref="dbSNP:76956384" variation 90 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="t" /db_xref="dbSNP:370214828" variation 98 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="a" /replace="c" /db_xref="dbSNP:376583344" CDS 106..519 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /note="cellular retinoic acid-binding protein I" /codon_start=1 /product="cellular retinoic acid-binding protein 1" /protein_id="NP_004369.1" /db_xref="GI:4758052" /db_xref="CCDS:CCDS10301.1" /db_xref="GeneID:1381" /db_xref="HGNC:2338" /db_xref="HPRD:07520" /db_xref="MIM:180230" /translation="
MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE
" misc_feature 118..516 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /note="Lipocalin / cytosolic fatty-acid binding protein family; Region: Lipocalin; pfam00061" /db_xref="CDD:215686" misc_feature 166..198 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P29762.2); Region: Nuclear localization signal (By similarity)" misc_feature 499..507 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P29762.2); Region: Retinoic acid binding (By similarity)" variation 117 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="t" /db_xref="dbSNP:143159972" variation 165 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="g" /db_xref="dbSNP:1127472" exon 176..354 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /inference="alignment:Splign:1.39.8" STS 182..354 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /standard_name="Crabp1" /db_xref="UniSTS:141393" variation 210 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="g" /db_xref="dbSNP:151297065" variation 238 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="t" /db_xref="dbSNP:377695187" variation 276 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="g" /db_xref="dbSNP:144623327" STS 297..448 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /standard_name="Crabp1" /db_xref="UniSTS:186507" variation 309 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="t" /db_xref="dbSNP:139444854" variation 350 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="g" /replace="t" /db_xref="dbSNP:201917878" variation 354 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="g" /db_xref="dbSNP:372532542" exon 355..468 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /inference="alignment:Splign:1.39.8" variation 359 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="t" /db_xref="dbSNP:372825750" variation 364 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="a" /replace="g" /db_xref="dbSNP:370616671" variation 389 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="a" /replace="t" /db_xref="dbSNP:374536418" variation 403 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="t" /db_xref="dbSNP:146054360" variation 415 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="a" /replace="g" /db_xref="dbSNP:143976499" variation 417 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="t" /db_xref="dbSNP:146438158" variation 440 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="a" /replace="c" /db_xref="dbSNP:17851967" variation 445 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="a" /replace="c" /db_xref="dbSNP:139860189" exon 469..772 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /inference="alignment:Splign:1.39.8" variation 471 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="a" /replace="g" /db_xref="dbSNP:201961718" variation 477 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="t" /db_xref="dbSNP:201099878" variation 480 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="t" /db_xref="dbSNP:369611524" variation 485 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="a" /replace="g" /db_xref="dbSNP:373989417" variation 487 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="a" /replace="g" /db_xref="dbSNP:185656115" STS 489..742 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /standard_name="WI-20012" /db_xref="UniSTS:43715" variation 516 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="a" /replace="g" /db_xref="dbSNP:78554547" STS 523..760 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /standard_name="D15S1227" /db_xref="UniSTS:26305" STS 536..742 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /standard_name="STS-W95693" /db_xref="UniSTS:43714" variation 597 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="t" /db_xref="dbSNP:188311015" variation 603 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="a" /replace="g" /db_xref="dbSNP:180673426" variation 627 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="a" /replace="g" /db_xref="dbSNP:373890664" variation 704 /gene="CRABP1" /gene_synonym="CRABP; CRABP-I; CRABPI; RBP5" /replace="c" /replace="t" /db_xref="dbSNP:140883903" ORIGIN
aaggcgcgcagcgctgggcgcaaagcgccagtctccgccttgcgagctcagagtgtgcccgctgcgccgccgctgtccgtacctgccgccgccgccaccgccaccatgcccaacttcgccggcacctggaagatgcgcagcagcgagaatttcgacgagctgctcaaggcactgggtgtgaacgccatgctgaggaaagtggccgtagcggctgcgtccaagccgcacgtggagatccgccaggacggggatcagttctacatcaagacatccaccacggtgcgcaccactgagatcaacttcaaggtcggagaaggctttgaggaggagaccgtggacggacgcaagtgcaggagtttagccacttgggagaatgagaacaagatccactgcacgcaaactcttcttgaaggggacggccccaaaacctactggacccgtgagctggccaacgatgaacttatcctgacgtttggcgccgatgacgtggtctgcaccagaatttatgtccgagagtgaaggcagctggcttgctcctactttcaggaagggatgcaggctcccctgaggaatatgtcatagttctgagctgccagtggaccgcccttttcccctaccaatattaggtgatcccgttttccccatgacaatgttgtagtgtcccccacccccaccccccaggccttggtgcctcttgtatccctagtgctccatagtttggcatttgcacggtttcgaagtcattaaactggttagacgtgtctcaacctttaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:1381 -> Molecular function: GO:0001972 [retinoic acid binding] evidence: IEA GeneID:1381 -> Molecular function: GO:0005215 [transporter activity] evidence: IEA GeneID:1381 -> Molecular function: GO:0005501 [retinoid binding] evidence: TAS GeneID:1381 -> Molecular function: GO:0016918 [retinal binding] evidence: IEA GeneID:1381 -> Molecular function: GO:0019841 [retinol binding] evidence: IEA GeneID:1381 -> Biological process: GO:0007165 [signal transduction] evidence: TAS GeneID:1381 -> Biological process: GO:0007275 [multicellular organismal development] evidence: TAS GeneID:1381 -> Cellular component: GO:0005829 [cytosol] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.