GGRNA Home | Help | Advanced search

2019-03-23 03:03:13, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_004376               6450 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens cytochrome c oxidase assembly homolog 15 (yeast)
            (COX15), transcript variant 2, mRNA.
ACCESSION   NM_004376
VERSION     NM_004376.5  GI:189011539
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 6450)
  AUTHORS   Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K.,
            Gibbs,R.A. and Butte,N.F.
  TITLE     Novel genetic loci identified for the pathophysiology of childhood
            obesity in the Hispanic population
  JOURNAL   PLoS ONE 7 (12), E51954 (2012)
   PUBMED   23251661
REFERENCE   2  (bases 1 to 6450)
  AUTHORS   Kenny,E.E., Pe'er,I., Karban,A., Ozelius,L., Mitchell,A.A.,
            Ng,S.M., Erazo,M., Ostrer,H., Abraham,C., Abreu,M.T., Atzmon,G.,
            Barzilai,N., Brant,S.R., Bressman,S., Burns,E.R., Chowers,Y.,
            Clark,L.N., Darvasi,A., Doheny,D., Duerr,R.H., Eliakim,R.,
            Giladi,N., Gregersen,P.K., Hakonarson,H., Jones,M.R., Marder,K.,
            McGovern,D.P., Mulle,J., Orr-Urtreger,A., Proctor,D.D., Pulver,A.,
            Rotter,J.I., Silverberg,M.S., Ullman,T., Warren,S.T., Waterman,M.,
            Zhang,W., Bergman,A., Mayer,L., Katz,S., Desnick,R.J., Cho,J.H. and
            Peter,I.
  TITLE     A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests
            novel susceptibility loci
  JOURNAL   PLoS Genet. 8 (3), E1002559 (2012)
   PUBMED   22412388
REFERENCE   3  (bases 1 to 6450)
  AUTHORS   Hendrickson,S.L., Lautenberger,J.A., Chinn,L.W., Malasky,M.,
            Sezgin,E., Kingsley,L.A., Goedert,J.J., Kirk,G.D., Gomperts,E.D.,
            Buchbinder,S.P., Troyer,J.L. and O'Brien,S.J.
  TITLE     Genetic variants in nuclear-encoded mitochondrial genes influence
            AIDS progression
  JOURNAL   PLoS ONE 5 (9), E12862 (2010)
   PUBMED   20877624
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 6450)
  AUTHORS   Vitali,M., Venturelli,E., Galimberti,D., Benerini Gatta,L.,
            Scarpini,E. and Finazzi,D.
  TITLE     Analysis of the genes coding for subunit 10 and 15 of cytochrome c
            oxidase in Alzheimer's disease
  JOURNAL   J Neural Transm 116 (12), 1635-1641 (2009)
   PUBMED   19826901
  REMARK    GeneRIF: COX 15 mRNA was significantly more abundant in the
            cerebral tissue of Alzheimer's disease (AD) patients and COX10 and
            COX15 SNP were significantly less represented in the patient group,
            suggesting a possible protective role toward the risk for AD
            GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   5  (bases 1 to 6450)
  AUTHORS   Dassa,E.P., Dufour,E., Goncalves,S., Paupe,V., Hakkaart,G.A.,
            Jacobs,H.T. and Rustin,P.
  TITLE     Expression of the alternative oxidase complements cytochrome c
            oxidase deficiency in human cells
  JOURNAL   EMBO Mol Med 1 (1), 30-36 (2009)
   PUBMED   20049701
  REMARK    GeneRIF: The expression of the AOX, well-tolerated by the cells,
            compensates for both the growth defect and the pronounced
            oxidant-sensitivity of COX-deficient human cells.
REFERENCE   6  (bases 1 to 6450)
  AUTHORS   Oquendo,C.E., Antonicka,H., Shoubridge,E.A., Reardon,W. and
            Brown,G.K.
  TITLE     Functional and genetic studies demonstrate that mutation in the
            COX15 gene can cause Leigh syndrome
  JOURNAL   J. Med. Genet. 41 (7), 540-544 (2004)
   PUBMED   15235026
  REMARK    GeneRIF: A patient with typical clinical and neuroradiological
            features of Leigh syndrome and cytochrome oxidase deficiency was
            found to have a mutation in the COX15 gene.
REFERENCE   7  (bases 1 to 6450)
  AUTHORS   Antonicka,H., Mattman,A., Carlson,C.G., Glerum,D.M., Hoffbuhr,K.C.,
            Leary,S.C., Kennaway,N.G. and Shoubridge,E.A.
  TITLE     Mutations in COX15 produce a defect in the mitochondrial heme
            biosynthetic pathway, causing early-onset fatal hypertrophic
            cardiomyopathy
  JOURNAL   Am. J. Hum. Genet. 72 (1), 101-114 (2003)
   PUBMED   12474143
  REMARK    GeneRIF: Mutations in COX15 produce a defect in the mitochondrial
            heme biosynthetic pathway, causing early-onset fatal hypertrophic
            cardiomyopathy
REFERENCE   8  (bases 1 to 6450)
  AUTHORS   Barros,M.H., Carlson,C.G., Glerum,D.M. and Tzagoloff,A.
  TITLE     Involvement of mitochondrial ferredoxin and Cox15p in hydroxylation
            of heme O
  JOURNAL   FEBS Lett. 492 (1-2), 133-138 (2001)
   PUBMED   11248251
REFERENCE   9  (bases 1 to 6450)
  AUTHORS   Petruzzella,V., Tiranti,V., Fernandez,P., Ianna,P., Carrozzo,R. and
            Zeviani,M.
  TITLE     Identification and characterization of human cDNAs specific to
            BCS1, PET112, SCO1, COX15, and COX11, five genes involved in the
            formation and function of the mitochondrial respiratory chain
  JOURNAL   Genomics 54 (3), 494-504 (1998)
   PUBMED   9878253
REFERENCE   10 (bases 1 to 6450)
  AUTHORS   Kennaway,N.G., Carrero-Valenzuela,R.D., Ewart,G., Balan,V.K.,
            Lightowlers,R., Zhang,Y.Z., Powell,B.R., Capaldi,R.A. and
            Buist,N.R.
  TITLE     Isoforms of mammalian cytochrome c oxidase: correlation with human
            cytochrome c oxidase deficiency
  JOURNAL   Pediatr. Res. 28 (5), 529-535 (1990)
   PUBMED   2175025
  REMARK    Review article
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BX537557.1, DB094258.1,
            AF044323.1, BC078161.1 and AL133353.6.
            This sequence is a reference standard in the RefSeqGene project.
            On May 22, 2008 this sequence version replaced gi:156071495.
            
            Summary: Cytochrome c oxidase (COX), the terminal component of the
            mitochondrial respiratory chain, catalyzes the electron transfer
            from reduced cytochrome c to oxygen. This component is a
            heteromeric complex consisting of 3 catalytic subunits encoded by
            mitochondrial genes and multiple structural subunits encoded by
            nuclear genes. The mitochondrially-encoded subunits function in
            electron transfer, and the nuclear-encoded subunits may function in
            the regulation and assembly of the complex. This nuclear gene
            encodes a protein which is not a structural subunit, but may be
            essential for the biogenesis of COX formation and may function in
            the hydroxylation of heme O, according to the yeast mutant studies.
            This protein is predicted to contain 5 transmembrane domains
            localized in the mitochondrial inner membrane. Alternative splicing
            of this gene generates two transcript variants diverging in the 3'
            region. [provided by RefSeq, Jul 2008].
            
            Transcript Variant: This variant (2) lacks an internal segment in
            the 3' region, as compared to variant 1. The encoded isoform 2 has
            a shorter and distinct C-terminus, as compared to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF044323.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025094 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            gene product(s) localized to mito. :: reported by MitoCarta
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-71                BX537557.1         1-71
            72-182              DB094258.1         73-183
            183-893             BX537557.1         183-893
            894-1736            AF044323.1         328-1170
            1737-3354           BC078161.1         2388-4005
            3355-6450           AL133353.6         57310-60405         c
FEATURES             Location/Qualifiers
     source          1..6450
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="10"
                     /map="10q24"
     gene            1..6450
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /note="cytochrome c oxidase assembly homolog 15 (yeast)"
                     /db_xref="GeneID:1355"
                     /db_xref="HGNC:2263"
                     /db_xref="HPRD:04707"
                     /db_xref="MIM:603646"
     exon            1..707
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /inference="alignment:Splign:1.39.8"
     variation       175
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2231674"
     variation       183
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2231675"
     misc_feature    387..389
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /note="upstream in-frame stop codon"
     variation       525
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2231676"
     variation       592
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2231677"
     variation       595
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2231678"
     CDS             618..1784
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /note="isoform 2 is encoded by transcript variant 2;
                     cytochrome c oxidase subunit 15; cytochrome c oxidase
                     assembly protein COX15 homolog; COX15 homolog, cytochrome
                     c oxidase assembly protein"
                     /codon_start=1
                     /product="cytochrome c oxidase assembly protein COX15
                     homolog isoform 2"
                     /protein_id="NP_004367.2"
                     /db_xref="GI:17921987"
                     /db_xref="CCDS:CCDS7481.1"
                     /db_xref="GeneID:1355"
                     /db_xref="HGNC:2263"
                     /db_xref="HPRD:04707"
                     /db_xref="MIM:603646"
                     /translation="
MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVALQSGRGTVSLPSKAAERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEYSHRMWGRLVGLVYILPAAYFWRKGWLSRGMKGRVLALCGLVCFQGLLGWYMVKSGLEEKSDSHDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPPHKLPETHQLLQLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESWIPEDLFTFSPILRNVFENPTMVQFDHRILGITSVTAITVLYFLSRRIPLPRRTKMAAVTLLALAYTQGPVLFNFTFKISDLDEGIRNI
"
     misc_feature    813..1718
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /note="Cytochrome oxidase assembly protein; Region:
                     COX15-CtaA; cl15852"
                     /db_xref="CDD:210252"
     misc_feature    816..1718
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /note="Uncharacterized protein required for cytochrome
                     oxidase assembly [Posttranslational modification, protein
                     turnover, chaperones]; Region: CtaA; COG1612"
                     /db_xref="CDD:31800"
     misc_feature    819..881
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q7KZN9.1);
                     transmembrane region"
     misc_feature    1077..1130
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q7KZN9.1);
                     transmembrane region"
     misc_feature    1167..1229
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q7KZN9.1);
                     transmembrane region"
     misc_feature    1296..1358
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q7KZN9.1);
                     transmembrane region"
     misc_feature    1422..1484
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q7KZN9.1);
                     transmembrane region"
     misc_feature    1587..1649
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q7KZN9.1);
                     transmembrane region"
     exon            708..889
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /inference="alignment:Splign:1.39.8"
     STS             743..874
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /standard_name="A008T04"
                     /db_xref="UniSTS:17407"
     exon            890..1012
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /inference="alignment:Splign:1.39.8"
     exon            1013..1199
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /inference="alignment:Splign:1.39.8"
     variation       1165
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35483721"
     exon            1200..1367
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /inference="alignment:Splign:1.39.8"
     variation       1281
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2231682"
     exon            1368..1449
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /inference="alignment:Splign:1.39.8"
     exon            1450..1604
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /inference="alignment:Splign:1.39.8"
     exon            1605..1718
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /inference="alignment:Splign:1.39.8"
     exon            1719..6450
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /inference="alignment:Splign:1.39.8"
     variation       1737
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2231687"
     variation       2701
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1802213"
     STS             3045..3220
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /standard_name="RH44559"
                     /db_xref="UniSTS:58606"
     variation       3079
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12416"
     variation       3260
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1128642"
     polyA_signal    3330..3335
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
     polyA_site      3354
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
     variation       5052
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1056844"
     STS             6274..6440
                     /gene="COX15"
                     /gene_synonym="CEMCOX2"
                     /standard_name="RH65628"
                     /db_xref="UniSTS:73963"
ORIGIN      
cacaaggtcgcagggccgttatgaggggaccccgggactcgaaccttggctccacagctgagccattctcgctacctgcccctcgtcacgccctccgtttccacacctttaacgcctcaaagatagaaggtgccgcccaaggggctggaaggagctgaggaaacgactccagaagaaatcaccactgactacgactcccgccggcccgccccggggagccttcggccgaccgtcccctcccccgccaccttccgcaccggccttcccggacggtatccgcgctcgttttcgctcagaggaggccccctgccttttcatgctccacgcgttcctccctcgtgcgcctgcagtttccacttggaatttgggctccggcgcgcaccagctaagaagcgcgtcaacagctgcgcgcgcccgtgcgcgcgtccccgacacctacgccccagcagcccccgcgaaagcggagtcgcaacgcaggcgcacttctgttcgctccggtccccagagaaggcggggctcccgctgcccgacccggaagtgcttctcttttccttggcggaggagggagaccacagagccctgggttgtggaagaggtggctgttccctgtcatcagtatgcagcgattgctctttccgccgttgagggccttgaaggggaggcagtatctgccgctcctggctcctagggcagcgcctagagcacagtgtgattgcatcaggcgccctttgaggccagggcaatacagcaccatctctgaagtagctttgcaatctggaaggggtacagtgtcccttccctcaaaggctgctgagcgggtggtgggccgatggctcctggtctgcagtggaacagtggctggagcagttattcttggtggagtaactaggttgacagagtctggcctctcgatggtagattggcatttaataaaggagatgaagccacctacaagccaagaggaatgggaagcagaattccaaagataccagcaatttccagaatttaaaatcttgaatcatgatatgacactgacagaattcaagttcatctggtacatggagtactcacaccgaatgtggggtcgccttgtaggccttgtgtacatcctgcctgctgcctacttttggagaaagggctggctcagccgtggcatgaaaggacgtgttcttgccctctgtggcctcgtctgcttccagggtctgttgggatggtatatggtgaaaagtggactagaagaaaaatcagactcccatgacatccctcgggtcagtcagtaccgccttgctgcccacctgggatcagccctggttctttattgtgccagcttgtggacctcactgtcactgctactccctccgcacaagttgcctgaaacccaccaactcctacagttgagacgatttgctcatggaacagcaggtctggtgttccttacggccctctcaggggcttttgtggcagggctagatgctgggcttgtttataactcctttcccaaaatgggagaatcctggatcccggaggacctctttaccttctcccccatcctgaggaatgtttttgagaatcccaccatggtgcagtttgatcaccggattctgggaatcacttcagtcactgccattacagtgctctacttcctctctcggagaattccccttcctagaaggaccaagatggcagcagtgactctgctggctttggcgtatacacagggccctgtcttattcaactttacttttaaaatcagtgatttggatgaaggcatcagaaacatctgatttgaggatggagcaacccaatattgctaatataatagatgacagtggcaactgaaaacagtcccagaatgaccccatcgagatgaaattaaacagattagaaatgtaacatactcatttaaattaaataagttgtataagtttgggctgaagaaacctggccttatatcatttcatataaaaaagacgggattttagttgtcctcaggttcaatatgaaccaagtagtattcatgttgttattatatgataacagaaaaattagtggtacttcaggttttatcagtagaagtgtcacagccatagtcaaaatacccctaacatactgcatttcactctgggtaccaaatttaagcaagatattgatggccactaagtgtgtatccagaagaagagatcagaatgatgagtccagaacccctgtcacacagggaataggtgaaggaactagggatatttaactggagcagagaacatctggagagagagcaagattcctgtccttgagaagttgaagccgtctcatgcagaagagggaatgagcttccattatgctgcagagctggcagcaatggatgaaagttgcaggaagttagttttagttctgtagaaggcaagagtagggtagaccaaatcaaatgctcactggggtcaggctgatggagacagtaacactggcgagcaggtgccccagctcggactatactgctgagttctggtctgttgctgccactctacaggtccagggttgttagatcttctgggtttttgttttgctttttgaaataaggaaaataagcttatcttaagtttatttttccttggatatacctagattccatacagtgacaatacaaatacaaaggaagaacatctggatttcatccttgacctcatttacaaagcaaaaagagatgctggattcagatataaatgtttaattttgcagtgtttaagtcagcaaatcttctgttttttaaaaataagccacatatctagatttttctgtgaaagctctcaattaagtgttgggaactaatttcaagattttaaaaaatgttatgcaggcttaacgtgtctgagagccataaatgacctaacgtttcccgttagtctctgaactaggtgatctcagttctctttcaactccagtactctgtaagtttctgtgacctgtagtgtaccattctcaggtggtgatatggtttggatgttttgtcccctccaaatctcatgttcaaagtgtgacattcagtgttagaggtgggcctagtaggaggtatttgggtcatgggggcggatcccttatgtatgactttgtgccatccccatagtaatgagtgagttctcactctggttgtttatgcaagagctggttgtttaaaagagcctggaacttcctcctctctcgcttgctctctctcaccatgtgacacactggctccccttcaccttctgccatgattgtaagcttcgtgaggccctcaccagaagcagatgccagcgccatgcttcctatacagttctatgcagaacagtgagccaaataaacctcttttctttctaaaaattgtcagtatttccttatagcaatgcaagccgactaacacaggtgattcttagcaaaacagtttgtcaatttttcataaatgctggaccctggctgggcttatgctattgcctagaagagattcccaacttctctcttatttgaatcttagaaaaatcccaaagcccaagcctcatctaagaccaattaagtcacaatccctggaggaagtaaaaggcatatttttaaagttccccaggtgattccaatgtgcagacaagtctagggaccactggcttaggtcctaatagcctagttaccttagaaagttctgactagcttattcccattcccttctaatttccaccccaccttatcatttgatctgctatgttgctcctattagtatgttagtaggatatggtctcttctggatagaatccttcaaagaaagggaactgtagttcctgaggcaggttcccacaccatcctctcctgatcctcaaacccaggttgtccttagttagtaactgagtcagcagagggcagtatgacccaacccaaagaaccatatattaatgcttctacagttgcctccaaggaagtagcaactcatgagtaagttaaggtttcagatgttttacttcatttttcttttattacagatgatgagtacatttggaaaaacaactggttgcatttagctatataactgtattatatctatgagcttctggtgaatgattatcttagggttttttttgtatttatgttattcccagcactcccagacacatatcaaatattgaattagtgaatgcatgaatggaaaatggataattacagattgatgttccaaatacctttttccaaaaaaacaagtcatcacatacctataggattaaatagatttcccttaatattttcaaaggtctctctgcacttacgtccattgtttttaaaacatgaaggaaattaaaacacatggctttcttaatcagtcaacctagaattttttgtctgtaacttagactgacaaatactatctattgtagcaggggtaatgactagcaactccctaaagcaatgttggttgcagagatcaacactgataatcatgattttaggataaccagtttatctacagctacccttgtggtcctgggatgaatggtgggttatatatcagcatatgtaacacatatacccatgtccctgcataagggagaatgcatcacctctctaacatgcatcacacattttcctcaacactgacctaaaatgtttgtcagtgagaattttaagaattcaaaattcaacaaaattattgtttaatgtgaagcagtagaaaaaacagagtcttaacaactccccaaagcaatgtaatacaggcagcctttggttttttaaagtgtagatcataataaaaagatgtctttcactacactccgcagaggccattgatcaaggtagaaataaagggggagtacatggcatgtacttcaggacttcaactaaagggtaattgtggaatgagaatttcaaatacaacatagtaactgaaacactagaaaccaaagtatgtgtctgggatccctgcttgcagaaaaacatttatgaagctagtaaggggcgtcttcaccagcagcaggccaaatgccggcaagtgctctgtaggaggggccacttaggaaagtaccagggctgccttggagtggagaaggaggagtggccaccagagggtatacaagtggttgccctttaaaagaagaggctcaggagcagacatgtctttatgctagcctgaagtcatgcatgtgtggctatacatagcctgtgattcagaagacttttcaactttggttttcataaaaatggcaagcaatgatggattacattttaaaagtgaaagcccttgtagtatgagtaatgattcagttttactaataaaaggatctccgtattgctcagattttcagagaaacaaaatggtcaactggtgtgttattccttcctcgtccctctgataacggtactgacaaactggaaaataatgaaatattagagcaaaagagaaatgtgtaataacacaagagaagtctattaggatataaggaagataagtagacagagcaggcttaaaatgaagcttgaacaagccatctgcagaaacagaaaacagggtagatgggacacccaaacagggtgccacagctttccaacttagatccaggttatgagagaatgagccaagaacacaacctaaaagttttcaatttgaggtatattcactgttgctattctatagtattaatcaaaatattattgactaataatcctgttattattaatcacaacttttggttttgagtcttagttttttaacagcaatattttttgtaacaccaggaaaatcctcacaagttattgccccaggggctggaatctggagctagcgtccctaagagactaatatgggagaatttgaaacatctgctatttctaccataattcttattcccaatcaacattacaccacataccacagcaaaaaggacaattagatactagttttgaattaatttgaaaagtttaaagacaacaaaaagaaacagccctctgtttctgtaacagagtctggaaactgcccaagaattacaacgaagttctttaatgaggtagatgtaataggcatttataccttcatctaggctgtagtcatctaatgaattgcttggatgttgtagtaaaggaaattgtataaaattgttttaaaaagatgtataaaatttaaaagtacgaaaagaaatacaggaacaagaatagatgtagtgaaaacttggcactatttctgacaaagtatttttttcaaagtttattcctaaatgtgagcaaagcagtcataaatgaatgtcagaagcagttgtaaagatggggcatggttagttgtggccagctgttttataaaaaatagattctgtttatacttgcagaaagattctgttaatgagcatttcattgtagctgacaaagtagttgggctaggaggccagtcactatgactttgcacatattacaactgctctaggcctcagttttatcacccatataaatcaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:1355 -> Molecular function: GO:0004129 [cytochrome-c oxidase activity] evidence: IGI
            GeneID:1355 -> Molecular function: GO:0004129 [cytochrome-c oxidase activity] evidence: TAS
            GeneID:1355 -> Molecular function: GO:0016627 [oxidoreductase activity, acting on the CH-CH group of donors] evidence: IEA
            GeneID:1355 -> Biological process: GO:0006123 [mitochondrial electron transport, cytochrome c to oxygen] evidence: IC
            GeneID:1355 -> Biological process: GO:0006778 [porphyrin-containing compound metabolic process] evidence: TAS
            GeneID:1355 -> Biological process: GO:0006783 [heme biosynthetic process] evidence: TAS
            GeneID:1355 -> Biological process: GO:0006784 [heme a biosynthetic process] evidence: IEA
            GeneID:1355 -> Biological process: GO:0006784 [heme a biosynthetic process] evidence: IGI
            GeneID:1355 -> Biological process: GO:0007585 [respiratory gaseous exchange] evidence: TAS
            GeneID:1355 -> Biological process: GO:0008535 [respiratory chain complex IV assembly] evidence: IMP
            GeneID:1355 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
            GeneID:1355 -> Biological process: GO:0045333 [cellular respiration] evidence: IC
            GeneID:1355 -> Biological process: GO:0055114 [oxidation-reduction process] evidence: TAS
            GeneID:1355 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA
            GeneID:1355 -> Cellular component: GO:0005743 [mitochondrial inner membrane] evidence: TAS
            GeneID:1355 -> Cellular component: GO:0005746 [mitochondrial respiratory chain] evidence: TAS
            GeneID:1355 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.