Home |
Help |
Advanced search
2024-04-20 06:02:42, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004356 1497 bp mRNA linear PRI 26-MAY-2013
DEFINITION Homo sapiens CD81 molecule (CD81), mRNA.
ACCESSION NM_004356
VERSION NM_004356.3 GI:62240999
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1497)
AUTHORS Davis,C., Harris,H.J., Hu,K., Drummer,H.E., McKeating,J.A.,
Mullins,J.G. and Balfe,P.
TITLE In silico directed mutagenesis identifies the CD81/claudin-1
hepatitis C virus receptor interface
JOURNAL Cell. Microbiol. 14 (12), 1892-1903 (2012)
PUBMED 22897233
REMARK GeneRIF: Fluorescent Resonance Energy Transfer studies confirm a
role for these CD81 residues in claudin-1 association and Hepatitis
C virus infection.
REFERENCE 2 (bases 1 to 1497)
AUTHORS Diao,J., Pantua,H., Ngu,H., Komuves,L., Diehl,L., Schaefer,G. and
Kapadia,S.B.
TITLE Hepatitis C virus induces epidermal growth factor receptor
activation via CD81 binding for viral internalization and entry
JOURNAL J. Virol. 86 (20), 10935-10949 (2012)
PUBMED 22855500
REMARK GeneRIF: data demonstrate that EGFR internalization is critical for
hepatitis C virus entry and identify a hitherto-unknown association
between CD81 and EGFR
REFERENCE 3 (bases 1 to 1497)
AUTHORS Rajesh,S., Sridhar,P., Tews,B.A., Feneant,L., Cocquerel,L.,
Ward,D.G., Berditchevski,F. and Overduin,M.
TITLE Structural basis of ligand interactions of the large extracellular
domain of tetraspanin CD81
JOURNAL J. Virol. 86 (18), 9606-9616 (2012)
PUBMED 22740401
REMARK GeneRIF: A novel membrane binding interface was revealed adjacent
to the exposed HCV interaction site in the extracellular loop of
CD81.
REFERENCE 4 (bases 1 to 1497)
AUTHORS Zhu,Y.Z., Luo,Y., Cao,M.M., Liu,Y., Liu,X.Q., Wang,W., Wu,D.G.,
Guan,M., Xu,Q.Q., Ren,H., Zhao,P. and Qi,Z.T.
TITLE Significance of palmitoylation of CD81 on its association with
tetraspanin-enriched microdomains and mediating hepatitis C virus
cell entry
JOURNAL Virology 429 (2), 112-123 (2012)
PUBMED 22560863
REMARK GeneRIF: These results suggest that palmitoylation of CD81 should
facilitate hepatitis C virus entry, at least in part, by regulating
the association of CD81 with tetraspanin-enriched microdomains.
REFERENCE 5 (bases 1 to 1497)
AUTHORS Cevik,S.I., Keskin,N., Belkaya,S., Ozlu,M.I., Deniz,E.,
Tazebay,U.H. and Erman,B.
TITLE CD81 interacts with the T cell receptor to suppress signaling
JOURNAL PLoS ONE 7 (11), E50396 (2012)
PUBMED 23226274
REMARK GeneRIF: CD81 interacts with the T cell receptor to suppress
signaling.
REFERENCE 6 (bases 1 to 1497)
AUTHORS Bradbury,L.E., Kansas,G.S., Levy,S., Evans,R.L. and Tedder,T.F.
TITLE The CD19/CD21 signal transducing complex of human B lymphocytes
includes the target of antiproliferative antibody-1 and Leu-13
molecules
JOURNAL J. Immunol. 149 (9), 2841-2850 (1992)
PUBMED 1383329
REFERENCE 7 (bases 1 to 1497)
AUTHORS Levy,S., Nguyen,V.Q., Andria,M.L. and Takahashi,S.
TITLE Structure and membrane topology of TAPA-1
JOURNAL J. Biol. Chem. 266 (22), 14597-14602 (1991)
PUBMED 1860863
REFERENCE 8 (bases 1 to 1497)
AUTHORS Andria,M.L., Hsieh,C.L., Oren,R., Francke,U. and Levy,S.
TITLE Genomic organization and chromosomal localization of the TAPA-1
gene
JOURNAL J. Immunol. 147 (3), 1030-1036 (1991)
PUBMED 1650385
REFERENCE 9 (bases 1 to 1497)
AUTHORS Takahashi,S., Doss,C., Levy,S. and Levy,R.
TITLE TAPA-1, the target of an antiproliferative antibody, is associated
on the cell surface with the Leu-13 antigen
JOURNAL J. Immunol. 145 (7), 2207-2213 (1990)
PUBMED 2398277
REFERENCE 10 (bases 1 to 1497)
AUTHORS Oren,R., Takahashi,S., Doss,C., Levy,R. and Levy,S.
TITLE TAPA-1, the target of an antiproliferative antibody, defines a new
family of transmembrane proteins
JOURNAL Mol. Cell. Biol. 10 (8), 4007-4015 (1990)
PUBMED 1695320
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BG397506.1, BQ709484.1,
M33680.1, BC002978.1 and CB055265.1.
This sequence is a reference standard in the RefSeqGene project.
On Apr 6, 2005 this sequence version replaced gi:21237760.
Summary: The protein encoded by this gene is a member of the
transmembrane 4 superfamily, also known as the tetraspanin family.
Most of these members are cell-surface proteins that are
characterized by the presence of four hydrophobic domains. The
proteins mediate signal transduction events that play a role in the
regulation of cell development, activation, growth and motility.
This encoded protein is a cell surface glycoprotein that is known
to complex with integrins. This protein appears to promote muscle
cell fusion and support myotube maintenance. Also it may be
involved in signal transduction. This gene is localized in the
tumor-suppressor gene region and thus it is a candidate gene for
malignancies. [provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC093047.1, M33680.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-18 BG397506.1 4-21
19-104 BQ709484.1 16-101
105-193 M33680.1 110-198
194-1475 BC002978.1 1-1282
1476-1497 CB055265.1 328-349
FEATURES Location/Qualifiers
source 1..1497
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="11"
/map="11p15.5"
gene 1..1497
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/note="CD81 molecule"
/db_xref="GeneID:975"
/db_xref="HGNC:1701"
/db_xref="HPRD:08924"
/db_xref="MIM:186845"
exon 1..299
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/inference="alignment:Splign:1.39.8"
variation 19
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:183863782"
variation 64
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="g"
/db_xref="dbSNP:11546014"
variation 231
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:376883566"
CDS 234..944
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/note="CD81 antigen (target of antiproliferative antibody
1); 26 kDa cell surface protein TAPA-1; tspan-28;
tetraspanin-28"
/codon_start=1
/product="CD81 antigen"
/protein_id="NP_004347.1"
/db_xref="GI:4757944"
/db_xref="CCDS:CCDS7734.1"
/db_xref="GeneID:975"
/db_xref="HGNC:1701"
/db_xref="HPRD:08924"
/db_xref="MIM:186845"
/translation="
MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
"
misc_feature 258..923
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/note="Tetraspanin family; Region: Tetraspannin;
pfam00335"
/db_xref="CDD:201163"
misc_feature 270..332
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P60033.1);
transmembrane region"
misc_feature 423..485
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P60033.1);
transmembrane region"
misc_feature 501..569
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P60033.1);
transmembrane region"
misc_feature 570..839
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/note="Tetraspanin, extracellular domain or large
extracellular loop (LEL), CD81_like subfamily.
Tetraspanins are trans-membrane proteins with 4
trans-membrane segments. Both the N- and C-termini lie on
the intracellular side of the membrane. This alignment...;
Region: CD81_like_LEL; cd03151"
/db_xref="CDD:48415"
misc_feature order(573..575,588..590,600..602,606..611,618..620,
666..668,678..683,690..695)
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/note="dimer interface [polypeptide binding]; other site"
/db_xref="CDD:48415"
misc_feature 837..905
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P60033.1);
transmembrane region"
STS 268..307
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/standard_name="Cd81"
/db_xref="UniSTS:141296"
exon 300..414
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/inference="alignment:Splign:1.39.8"
variation 311
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="c"
/db_xref="dbSNP:34400531"
variation 340
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="g"
/replace="t"
/db_xref="dbSNP:374100694"
variation 359
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="g"
/db_xref="dbSNP:370819047"
variation 392
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:200365372"
variation 394
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:368611423"
exon 415..512
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/inference="alignment:Splign:1.39.8"
variation 467
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:11546013"
variation 473
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:61731556"
variation 506
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:372129042"
exon 513..587
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/inference="alignment:Splign:1.39.8"
variation 521
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:202086417"
variation 557
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:138086545"
exon 588..692
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/inference="alignment:Splign:1.39.8"
variation 617
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="g"
/db_xref="dbSNP:376534440"
variation 636
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:181171080"
variation 647
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:143644902"
variation 659
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:369472934"
variation 686
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:146021958"
exon 693..794
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/inference="alignment:Splign:1.39.8"
variation 750
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:138631483"
variation 751
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:149336067"
exon 795..881
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/inference="alignment:Splign:1.39.8"
variation 816
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:144435973"
variation 817
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:184960624"
variation 821
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="c"
/db_xref="dbSNP:148404749"
variation 830
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:14077"
variation 848
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:375953854"
variation 863
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:145975232"
variation 864
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:139884987"
variation 869..870
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace=""
/replace="a"
/db_xref="dbSNP:35457972"
variation 869
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:144381255"
variation 870
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:373342342"
variation 872
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:2229751"
exon 882..1497
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/inference="alignment:Splign:1.39.8"
variation 887
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:139978456"
variation 893
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:371516232"
variation 950
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:188175983"
variation 951
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:368448552"
variation 984
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="g"
/db_xref="dbSNP:10645"
STS 986..1134
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/standard_name="WI-18911"
/db_xref="UniSTS:60814"
variation 1021
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:35800690"
variation 1035
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:74701050"
variation 1041
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:1063316"
variation 1060
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:1804493"
variation 1108
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:113585763"
variation 1144
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="g"
/db_xref="dbSNP:143793173"
variation 1185
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:1049390"
variation 1197..1198
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace=""
/replace="c"
/db_xref="dbSNP:34939011"
variation 1278
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:1049549"
STS 1324..1415
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/standard_name="SHGC-57855"
/db_xref="UniSTS:69665"
STS 1328..1447
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/standard_name="GDB:678191"
/db_xref="UniSTS:9560"
variation 1400
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="t"
/db_xref="dbSNP:1049648"
variation 1403..1404
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace=""
/replace="ac"
/db_xref="dbSNP:138604169"
variation 1406
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1049652"
variation 1407
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:183619205"
variation 1410
/gene="CD81"
/gene_synonym="CVID6; S5.7; TAPA1; TSPAN28"
/replace="a"
/replace="g"
/db_xref="dbSNP:1049659"
ORIGIN
gagcgagcgcgcaacggcggcgacggcggcgaccccaccgcgcatcctgccaggcctccggcgcccagcgccccacgcgcccccgcgcccccgcgcccccgcgcccctttcttcgcgcccccgcccctcggcccgccaggcccccttgccggccacccgccaggccccgcgccggcccgcccgccgcccaggaccggcccgcgccccgcaggccgcccgccgcccgcgccgccatgggagtggagggctgcaccaagtgcatcaagtacctgctcttcgtcttcaatttcgtcttctggctggctggaggcgtgatcctgggtgtggccctgtggctccgccatgacccgcagaccaccaacctcctgtatctggagctgggagacaagcccgcgcccaacaccttctatgtaggcatctacatcctcatcgctgtgggcgctgtcatgatgttcgttggcttcctgggctgctacggggccatccaggaatcccagtgcctgctggggacgttcttcacctgcctggtcatcctgtttgcctgtgaggtggccgccggcatctggggctttgtcaacaaggaccagatcgccaaggatgtgaagcagttctatgaccaggccctacagcaggccgtggtggatgatgacgccaacaacgccaaggctgtggtgaagaccttccacgagacgcttgactgctgtggctccagcacactgactgctttgaccacctcagtgctcaagaacaatttgtgtccctcgggcagcaacatcatcagcaacctcttcaaggaggactgccaccagaagatcgatgacctcttctccgggaagctgtacctcatcggcattgctgccatcgtggtcgctgtgatcatgatcttcgagatgatcctgagcatggtgctgtgctgtggcatccggaacagctccgtgtactgaggccccgcagctctggccacagggacctctgcagtgccccctaagtgacccggacacttccgagggggccatcaccgcctgtgtatataacgtttccggtattactctgctacacgtagcctttttacttttggggttttgtttttgttctgaactttcctgttaccttttcagggctgacgtcacatgtaggtggcgtgtatgagtggagacgggcctgggtcttggggactggagggcaggggtccttctgccctggggtcccagggtgctctgcctgctcagccaggcctctcctgggagccactcgcccagagactcagcttggccaacttggggggctgtgtccacccagcccgcccgtcctgtgggctgcacagctcaccttgttccctcctgccccggttcgagagccgagtctgtgggcactctctgccttcatgcacctgtcctttctaacacgtcgccttcaactgtaatcacaacatcctgactccgtcatttaataaagaaggaacatcaggcatgctaccaggcctgtgcagtccctcag
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:975 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:975 -> Biological process: GO:0000187 [activation of MAPK activity] evidence: IDA
GeneID:975 -> Biological process: GO:0006661 [phosphatidylinositol biosynthetic process] evidence: IDA
GeneID:975 -> Biological process: GO:0008104 [protein localization] evidence: IDA
GeneID:975 -> Biological process: GO:0008283 [cell proliferation] evidence: TAS
GeneID:975 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IDA
GeneID:975 -> Biological process: GO:0043128 [positive regulation of 1-phosphatidylinositol 4-kinase activity] evidence: IDA
GeneID:975 -> Biological process: GO:0046488 [phosphatidylinositol metabolic process] evidence: IDA
GeneID:975 -> Biological process: GO:0046718 [viral entry into host cell] evidence: TAS
GeneID:975 -> Biological process: GO:0046813 [virion attachment, binding of host cell surface receptor] evidence: TAS
GeneID:975 -> Biological process: GO:0050731 [positive regulation of peptidyl-tyrosine phosphorylation] evidence: IDA
GeneID:975 -> Biological process: GO:0050776 [regulation of immune response] evidence: TAS
GeneID:975 -> Cellular component: GO:0001772 [immunological synapse] evidence: IDA
GeneID:975 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
GeneID:975 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.