GGRNA Home | Help | Advanced search

2020-10-26 19:52:46, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_004343               1929 bp    mRNA    linear   PRI 01-JUL-2013
DEFINITION  Homo sapiens calreticulin (CALR), mRNA.
ACCESSION   NM_004343
VERSION     NM_004343.3  GI:209862753
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1929)
  AUTHORS   Kabbage,M., Trimeche,M., Bergaoui,S., Hammann,P., Kuhn,L.,
            Hamrita,B., ben Nasr,H., Chaieb,A., Chouchane,L. and Chahed,K.
  TITLE     Calreticulin expression in infiltrating ductal breast carcinomas:
            relationships with disease progression and humoral immune responses
  JOURNAL   Tumour Biol. 34 (2), 1177-1188 (2013)
   PUBMED   23334957
  REMARK    GeneRIF: Upregulation of calreticulin is associated with
            infiltrating ductal breast carcinomas.
REFERENCE   2  (bases 1 to 1929)
  AUTHORS   Ling,S., Cline,E.N., Haug,T.S., Fox,D.A. and Holoshitz,J.
  TITLE     Citrullinated calreticulin potentiates rheumatoid arthritis shared
            epitope signaling
  JOURNAL   Arthritis Rheum. 65 (3), 618-626 (2013)
   PUBMED   23233327
  REMARK    GeneRIF: Citrullinated CRT is overabundant in the rheumatoid
            arthritis synovium and potentiates shared epitope-activated
            signaling in vitro.
REFERENCE   3  (bases 1 to 1929)
  AUTHORS   Yang,M.S., Wang,H.S., Wang,B.S., Li,W.H., Pang,Z.F., Zou,B.K.,
            Zhang,X., Shi,X.T., Mu,D.B., Zhang,D.X., Gao,Y.S., Sun,X.W. and
            Xia,S.J.
  TITLE     A comparative proteomic study identified calreticulin and
            prohibitin up-regulated in adrenocortical carcinomas
  JOURNAL   Diagn Pathol 8, 58 (2013)
   PUBMED   23587357
  REMARK    GeneRIF: Calreticulin and prohibitin were identified to be novel
            candidate biomarkers for adrenocortical carcinomas.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1929)
  AUTHORS   van der Harst,P., Zhang,W., Mateo Leach,I., Rendon,A., Verweij,N.,
            Sehmi,J., Paul,D.S., Elling,U., Allayee,H., Li,X.,
            Radhakrishnan,A., Tan,S.T., Voss,K., Weichenberger,C.X.,
            Albers,C.A., Al-Hussani,A., Asselbergs,F.W., Ciullo,M., Danjou,F.,
            Dina,C., Esko,T., Evans,D.M., Franke,L., Gogele,M., Hartiala,J.,
            Hersch,M., Holm,H., Hottenga,J.J., Kanoni,S., Kleber,M.E.,
            Lagou,V., Langenberg,C., Lopez,L.M., Lyytikainen,L.P., Melander,O.,
            Murgia,F., Nolte,I.M., O'Reilly,P.F., Padmanabhan,S., Parsa,A.,
            Pirastu,N., Porcu,E., Portas,L., Prokopenko,I., Ried,J.S.,
            Shin,S.Y., Tang,C.S., Teumer,A., Traglia,M., Ulivi,S., Westra,H.J.,
            Yang,J., Zhao,J.H., Anni,F., Abdellaoui,A., Attwood,A., Balkau,B.,
            Bandinelli,S., Bastardot,F., Benyamin,B., Boehm,B.O., Cookson,W.O.,
            Das,D., de Bakker,P.I., de Boer,R.A., de Geus,E.J., de Moor,M.H.,
            Dimitriou,M., Domingues,F.S., Doring,A., Engstrom,G.,
            Eyjolfsson,G.I., Ferrucci,L., Fischer,K., Galanello,R.,
            Garner,S.F., Genser,B., Gibson,Q.D., Girotto,G., Gudbjartsson,D.F.,
            Harris,S.E., Hartikainen,A.L., Hastie,C.E., Hedblad,B., Illig,T.,
            Jolley,J., Kahonen,M., Kema,I.P., Kemp,J.P., Liang,L.,
            Lloyd-Jones,H., Loos,R.J., Meacham,S., Medland,S.E., Meisinger,C.,
            Memari,Y., Mihailov,E., Miller,K., Moffatt,M.F., Nauck,M.,
            Novatchkova,M., Nutile,T., Olafsson,I., Onundarson,P.T.,
            Parracciani,D., Penninx,B.W., Perseu,L., Piga,A., Pistis,G.,
            Pouta,A., Puc,U., Raitakari,O., Ring,S.M., Robino,A., Ruggiero,D.,
            Ruokonen,A., Saint-Pierre,A., Sala,C., Salumets,A., Sambrook,J.,
            Schepers,H., Schmidt,C.O., Sillje,H.H., Sladek,R., Smit,J.H.,
            Starr,J.M., Stephens,J., Sulem,P., Tanaka,T., Thorsteinsdottir,U.,
            Tragante,V., van Gilst,W.H., van Pelt,L.J., van Veldhuisen,D.J.,
            Volker,U., Whitfield,J.B., Willemsen,G., Winkelmann,B.R.,
            Wirnsberger,G., Algra,A., Cucca,F., d'Adamo,A.P., Danesh,J.,
            Deary,I.J., Dominiczak,A.F., Elliott,P., Fortina,P., Froguel,P.,
            Gasparini,P., Greinacher,A., Hazen,S.L., Jarvelin,M.R., Khaw,K.T.,
            Lehtimaki,T., Maerz,W., Martin,N.G., Metspalu,A., Mitchell,B.D.,
            Montgomery,G.W., Moore,C., Navis,G., Pirastu,M., Pramstaller,P.P.,
            Ramirez-Solis,R., Schadt,E., Scott,J., Shuldiner,A.R., Smith,G.D.,
            Smith,J.G., Snieder,H., Sorice,R., Spector,T.D., Stefansson,K.,
            Stumvoll,M., Tang,W.H., Toniolo,D., Tonjes,A., Visscher,P.M.,
            Vollenweider,P., Wareham,N.J., Wolffenbuttel,B.H., Boomsma,D.I.,
            Beckmann,J.S., Dedoussis,G.V., Deloukas,P., Ferreira,M.A.,
            Sanna,S., Uda,M., Hicks,A.A., Penninger,J.M., Gieger,C.,
            Kooner,J.S., Ouwehand,W.H., Soranzo,N. and Chambers,J.C.
  TITLE     Seventy-five genetic loci influencing the human red blood cell
  JOURNAL   Nature 492 (7429), 369-375 (2012)
   PUBMED   23222517
REFERENCE   5  (bases 1 to 1929)
  AUTHORS   Mans,S., Banz,Y., Mueller,B.U. and Pabst,T.
  TITLE     The angiogenesis inhibitor vasostatin is regulated by neutrophil
            elastase-dependent cleavage of calreticulin in AML patients
  JOURNAL   Blood 120 (13), 2690-2699 (2012)
   PUBMED   22915645
  REMARK    GeneRIF: High calreticulin is associated with acute myeloid
            leukemia.
REFERENCE   6  (bases 1 to 1929)
  AUTHORS   Hochstrasser,D.F., Frutiger,S., Paquet,N., Bairoch,A., Ravier,F.,
            Pasquali,C., Sanchez,J.C., Tissot,J.D., Bjellqvist,B., Vargas,R. et
            al.
  TITLE     Human liver protein map: a reference database established by
            microsequencing and gel comparison
  JOURNAL   Electrophoresis 13 (12), 992-1001 (1992)
   PUBMED   1286669
REFERENCE   7  (bases 1 to 1929)
  AUTHORS   Rasmussen,H.H., van Damme,J., Puype,M., Gesser,B., Celis,J.E. and
            Vandekerckhove,J.
  TITLE     Microsequences of 145 proteins recorded in the two-dimensional gel
            protein database of normal human epidermal keratinocytes
  JOURNAL   Electrophoresis 13 (12), 960-969 (1992)
   PUBMED   1286667
REFERENCE   8  (bases 1 to 1929)
  AUTHORS   McCauliffe,D.P., Yang,Y.S., Wilson,J., Sontheimer,R.D. and
            Capra,J.D.
  TITLE     The 5'-flanking region of the human calreticulin gene shares
            homology with the human GRP78, GRP94, and protein disulfide
            isomerase promoters
  JOURNAL   J. Biol. Chem. 267 (4), 2557-2562 (1992)
   PUBMED   1733953
REFERENCE   9  (bases 1 to 1929)
  AUTHORS   Rokeach,L.A., Haselby,J.A., Meilof,J.F., Smeenk,R.J., Unnasch,T.R.,
            Greene,B.M. and Hoch,S.O.
  TITLE     Characterization of the autoantigen calreticulin
  JOURNAL   J. Immunol. 147 (9), 3031-3039 (1991)
   PUBMED   1919005
REFERENCE   10 (bases 1 to 1929)
  AUTHORS   Rojiani,M.V., Finlay,B.B., Gray,V. and Dedhar,S.
  TITLE     In vitro interaction of a polypeptide homologous to human Ro/SS-A
            antigen (calreticulin) with a highly conserved amino acid sequence
            in the cytoplasmic domain of integrin alpha subunits
  JOURNAL   Biochemistry 30 (41), 9859-9866 (1991)
   PUBMED   1911778
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC092069.2 and BC007911.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Oct 21, 2008 this sequence version replaced gi:5921996.
            
            Summary: Calreticulin is a multifunctional protein that acts as a
            major Ca(2+)-binding (storage) protein in the lumen of the
            endoplasmic reticulum. It is also found in the nucleus, suggesting
            that it may have a role in transcription regulation. Calreticulin
            binds to the synthetic peptide KLGFFKR, which is almost identical
            to an amino acid sequence in the DNA-binding domain of the
            superfamily of nuclear receptors. Calreticulin binds to antibodies
            in certain sera of systemic lupus and Sjogren patients which
            contain anti-Ro/SSA antibodies, it is highly conserved among
            species, and it is located in the endoplasmic and sarcoplasmic
            reticulum where it may bind calcium. The amino terminus of
            calreticulin interacts with the DNA-binding domain of the
            glucocorticoid receptor and prevents the receptor from binding to
            its specific glucocorticoid response element. Calreticulin can
            inhibit the binding of androgen receptor to its hormone-responsive
            DNA element and can inhibit androgen receptor and retinoic acid
            receptor transcriptional activities in vivo, as well as retinoic
            acid-induced neuronal differentiation. Thus, calreticulin can act
            as an important modulator of the regulation of gene transcription
            by nuclear hormone receptors. Systemic lupus erythematosus is
            associated with increased autoantibody titers against calreticulin
            but calreticulin is not a Ro/SS-A antigen. Earlier papers referred
            to calreticulin as an Ro/SS-A antigen but this was later disproven.
            Increased autoantibody titer against human calreticulin is found in
            infants with complete congenital heart block of both the IgG and
            IgM classes. [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC007911.1, M84739.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-171               AC092069.2         50907-51077         c
            172-273             AC092069.2         50442-50543         c
            274-477             AC092069.2         50046-50249         c
            478-572             AC092069.2         49530-49624         c
            573-782             AC092069.2         49225-49434         c
            783-896             AC092069.2         49023-49136         c
            897-1040            AC092069.2         48790-48933         c
            1041-1133           AC092069.2         46048-46140         c
            1134-1881           AC092069.2         45217-45964         c
            1882-1929           BC007911.1         1873-1920
FEATURES             Location/Qualifiers
     source          1..1929
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19p13.3-p13.2"
     gene            1..1929
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /note="calreticulin"
                     /db_xref="GeneID:811"
                     /db_xref="HGNC:1455"
                     /db_xref="HPRD:00169"
                     /db_xref="MIM:109091"
     exon            1..171
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /inference="alignment:Splign:1.39.8"
     variation       2
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:28365950"
     variation       21
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41300080"
     variation       33
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374628652"
     misc_feature    45..47
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /note="upstream in-frame stop codon"
     variation       60
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11547567"
     variation       72
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370935055"
     variation       77
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190251647"
     CDS             81..1334
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /note="Sicca syndrome antigen A (autoantigen Ro;
                     calreticulin); CRP55; ERp60; HACBP; grp60; calregulin;
                     endoplasmic reticulum resident protein 60"
                     /codon_start=1
                     /product="calreticulin precursor"
                     /protein_id="NP_004334.1"
                     /db_xref="GI:4757900"
                     /db_xref="CCDS:CCDS12288.1"
                     /db_xref="GeneID:811"
                     /db_xref="HGNC:1455"
                     /db_xref="HPRD:00169"
                     /db_xref="MIM:109091"
                     /translation="
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
"
     sig_peptide     81..131
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     mat_peptide     132..1331
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /product="calreticulin"
     misc_feature    132..671
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P27797.1);
                     Region: N-domain"
     misc_feature    144..1076
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /note="Calreticulin family; Region: Calreticulin;
                     pfam00262"
                     /db_xref="CDD:189477"
     misc_feature    222..224
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N6-acetyllysine; propagated from
                     UniProtKB/Swiss-Prot (P27797.1); acetylation site"
     misc_feature    555..557
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N6-acetyllysine; propagated from
                     UniProtKB/Swiss-Prot (P27797.1); acetylation site"
     misc_feature    651..845
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P27797.1);
                     Region: 4 X approximate repeats"
     misc_feature    672..1004
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P27797.1);
                     Region: P-domain"
     misc_feature    705..707
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N6-acetyllysine; propagated from
                     UniProtKB/Swiss-Prot (P27797.1); acetylation site"
     misc_feature    855..971
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P27797.1);
                     Region: 3 X approximate repeats"
     misc_feature    1005..1331
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P27797.1);
                     Region: C-domain"
     misc_feature    1320..1331
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P27797.1);
                     Region: Prevents secretion from ER"
     variation       99
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201581541"
     variation       113
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368501056"
     variation       130
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147368353"
     exon            172..273
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /inference="alignment:Splign:1.39.8"
     variation       172
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146793150"
     variation       174
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377744854"
     variation       175
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140472880"
     variation       185
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145899020"
     variation       250
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138503495"
     variation       251
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200631709"
     variation       257
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:76337616"
     exon            274..477
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /inference="alignment:Splign:1.39.8"
     variation       297
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370585408"
     variation       323
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11547568"
     variation       349
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373993748"
     variation       350
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199928255"
     variation       357
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370869315"
     variation       404
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375093236"
     variation       407
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201824031"
     variation       416
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202106445"
     variation       432
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201017921"
     variation       461
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:375318260"
     variation       463
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200421584"
     variation       466
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200105930"
     exon            478..572
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /inference="alignment:Splign:1.39.8"
     variation       482
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371325705"
     variation       510
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149216548"
     variation       531
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:192388573"
     variation       542
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143361476"
     exon            573..782
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /inference="alignment:Splign:1.39.8"
     variation       574
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148345745"
     variation       587
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:187996595"
     variation       596
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141216842"
     variation       602
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201344231"
     variation       606
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11547569"
     variation       646
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147369833"
     variation       659
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146732841"
     variation       674
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143370494"
     variation       675
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199565419"
     variation       686
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:79497711"
     variation       717
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369547041"
     variation       727
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200173883"
     variation       728
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200486676"
     variation       745
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371806484"
     variation       755
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139658454"
     variation       762
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149740908"
     exon            783..896
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /inference="alignment:Splign:1.39.8"
     variation       818
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370254574"
     variation       830
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:144562269"
     variation       851
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371463754"
     variation       861
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11547563"
     variation       867
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148447453"
     variation       878
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:372688428"
     exon            897..1040
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /inference="alignment:Splign:1.39.8"
     variation       897
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:367922867"
     variation       938
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11547562"
     variation       983
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371988722"
     variation       984
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375135016"
     variation       1016
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:111306057"
     variation       1028
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370016483"
     variation       1032
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372777769"
     exon            1041..1133
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /inference="alignment:Splign:1.39.8"
     variation       1074
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368136620"
     variation       1082
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146803878"
     variation       1091
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140610430"
     variation       1125
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144233437"
     exon            1134..1911
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /inference="alignment:Splign:1.39.8"
     variation       1166
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151032910"
     variation       1219
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201971744"
     variation       1222
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:143880510"
     variation       1232
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370029737"
     variation       1259
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374121178"
     variation       1272
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150264068"
     variation       1298
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186827895"
     variation       1301
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11547565"
     variation       1325
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148604761"
     STS             1345..1589
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /standard_name="STS-M84739"
                     /db_xref="UniSTS:36938"
     variation       1367
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201689726"
     variation       1370
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376336055"
     variation       1371
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200311949"
     variation       1379
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370833569"
     variation       1388
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1049481"
     variation       1454
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1063382"
     variation       1508
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1063386"
     variation       1509
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1063387"
     variation       1510
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:16978824"
     variation       1511..1512
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace=""
                     /replace="tt"
                     /db_xref="dbSNP:71813450"
     variation       1511
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1063388"
     variation       1511
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:371347484"
     variation       1528
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace=""
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:58546164"
     variation       1621
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1063415"
     variation       1630
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1803237"
     variation       1631
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191183059"
     variation       1728
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11210"
     variation       1744
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:9978"
     variation       1783..1784
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:35275976"
     variation       1784
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1803236"
     variation       1795
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1050279"
     variation       1796..1797
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:35885654"
     variation       1823
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1050434"
     variation       1833
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1801594"
     variation       1847
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:15340"
     polyA_signal    1894..1899
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
     polyA_site      1911
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
     variation       1911
                     /gene="CALR"
                     /gene_synonym="cC1qR; CRT; RO; SSA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3177935"
ORIGIN      
gcggcgtccgtccgtactgcagagccgctgccggagggtcgttttaaagggcccgcgcgttgccgccccctcggcccgccatgctgctatccgtgccgctgctgctcggcctcctcggcctggccgtcgccgagcctgccgtctacttcaaggagcagtttctggacggagacgggtggacttcccgctggatcgaatccaaacacaagtcagattttggcaaattcgttctcagttccggcaagttctacggtgacgaggagaaagataaaggtttgcagacaagccaggatgcacgcttttatgctctgtcggccagtttcgagcctttcagcaacaaaggccagacgctggtggtgcagttcacggtgaaacatgagcagaacatcgactgtgggggcggctatgtgaagctgtttcctaatagtttggaccagacagacatgcacggagactcagaatacaacatcatgtttggtcccgacatctgtggccctggcaccaagaaggttcatgtcatcttcaactacaagggcaagaacgtgctgatcaacaaggacatccgttgcaaggatgatgagtttacacacctgtacacactgattgtgcggccagacaacacctatgaggtgaagattgacaacagccaggtggagtccggctccttggaagacgattgggacttcctgccacccaagaagataaaggatcctgatgcttcaaaaccggaagactgggatgagcgggccaagatcgatgatcccacagactccaagcctgaggactgggacaagcccgagcatatccctgaccctgatgctaagaagcccgaggactgggatgaagagatggacggagagtgggaacccccagtgattcagaaccctgagtacaagggtgagtggaagccccggcagatcgacaacccagattacaagggcacttggatccacccagaaattgacaaccccgagtattctcccgatcccagtatctatgcctatgataactttggcgtgctgggcctggacctctggcaggtcaagtctggcaccatctttgacaacttcctcatcaccaacgatgaggcatacgctgaggagtttggcaacgagacgtggggcgtaacaaaggcagcagagaaacaaatgaaggacaaacaggacgaggagcagaggcttaaggaggaggaagaagacaagaaacgcaaagaggaggaggaggcagaggacaaggaggatgatgaggacaaagatgaggatgaggaggatgaggaggacaaggaggaagatgaggaggaagatgtccccggccaggccaaggacgagctgtagagaggcctgcctccagggctggactgaggcctgagcgctcctgccgcagagctggccgcgccaaataatgtctctgtgagactcgagaactttcatttttttccaggctggttcggatttggggtggattttggttttgttcccctcctccactctcccccaccccctccccgcccttttttttttttttttttaaactggtattttatctttgattctccttcagccctcacccctggttctcatctttcttgatcaacatcttttcttgcctctgtccccttctctcatctcttagctcccctccaacctggggggcagtggtgtggagaagccacaggcctgagatttcatctgctctccttcctggagcccagaggagggcagcagaagggggtggtgtctccaaccccccagcactgaggaagaacggggctcttctcatttcacccctccctttctcccctgcccccaggactgggccacttctgggtggggcagtgggtcccagattggctcacactgagaatgtaagaactacaaacaaaatttctattaaattaaattttgtgtctccaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:811 -> Molecular function: GO:0001849 [complement component C1q binding] evidence: TAS
            GeneID:811 -> Molecular function: GO:0003677 [DNA binding] evidence: NAS
            GeneID:811 -> Molecular function: GO:0003729 [mRNA binding] evidence: IDA
            GeneID:811 -> Molecular function: GO:0005178 [integrin binding] evidence: IPI
            GeneID:811 -> Molecular function: GO:0005506 [iron ion binding] evidence: IEA
            GeneID:811 -> Molecular function: GO:0005509 [calcium ion binding] evidence: ISS
            GeneID:811 -> Molecular function: GO:0005509 [calcium ion binding] evidence: TAS
            GeneID:811 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:811 -> Molecular function: GO:0008270 [zinc ion binding] evidence: TAS
            GeneID:811 -> Molecular function: GO:0030246 [carbohydrate binding] evidence: TAS
            GeneID:811 -> Molecular function: GO:0031625 [ubiquitin protein ligase binding] evidence: IPI
            GeneID:811 -> Molecular function: GO:0042277 [peptide binding] evidence: IEA
            GeneID:811 -> Molecular function: GO:0042562 [hormone binding] evidence: IEA
            GeneID:811 -> Molecular function: GO:0044183 [protein binding involved in protein folding] evidence: TAS
            GeneID:811 -> Molecular function: GO:0050681 [androgen receptor binding] evidence: IDA
            GeneID:811 -> Molecular function: GO:0051082 [unfolded protein binding] evidence: TAS
            GeneID:811 -> Molecular function: GO:0051087 [chaperone binding] evidence: TAS
            GeneID:811 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: IDA
            GeneID:811 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS
            GeneID:811 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS
            GeneID:811 -> Biological process: GO:0002502 [peptide antigen assembly with MHC class I protein complex] evidence: ISS
            GeneID:811 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: TAS
            GeneID:811 -> Biological process: GO:0006457 [protein folding] evidence: TAS
            GeneID:811 -> Biological process: GO:0006611 [protein export from nucleus] evidence: IDA
            GeneID:811 -> Biological process: GO:0006874 [cellular calcium ion homeostasis] evidence: TAS
            GeneID:811 -> Biological process: GO:0006987 [activation of signaling protein activity involved in unfolded protein response] evidence: TAS
            GeneID:811 -> Biological process: GO:0007050 [cell cycle arrest] evidence: IGI
            GeneID:811 -> Biological process: GO:0007283 [spermatogenesis] evidence: IEA
            GeneID:811 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IGI
            GeneID:811 -> Biological process: GO:0010628 [positive regulation of gene expression] evidence: IEA
            GeneID:811 -> Biological process: GO:0017148 [negative regulation of translation] evidence: ISS
            GeneID:811 -> Biological process: GO:0017148 [negative regulation of translation] evidence: TAS
            GeneID:811 -> Biological process: GO:0018279 [protein N-linked glycosylation via asparagine] evidence: TAS
            GeneID:811 -> Biological process: GO:0022417 [protein maturation by protein folding] evidence: TAS
            GeneID:811 -> Biological process: GO:0030866 [cortical actin cytoskeleton organization] evidence: IEA
            GeneID:811 -> Biological process: GO:0030968 [endoplasmic reticulum unfolded protein response] evidence: TAS
            GeneID:811 -> Biological process: GO:0032355 [response to estradiol stimulus] evidence: IEA
            GeneID:811 -> Biological process: GO:0033144 [negative regulation of intracellular steroid hormone receptor signaling pathway] evidence: IDA
            GeneID:811 -> Biological process: GO:0033574 [response to testosterone stimulus] evidence: IEA
            GeneID:811 -> Biological process: GO:0034504 [protein localization to nucleus] evidence: IDA
            GeneID:811 -> Biological process: GO:0040020 [regulation of meiosis] evidence: IEA
            GeneID:811 -> Biological process: GO:0042493 [response to drug] evidence: IEA
            GeneID:811 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS
            GeneID:811 -> Biological process: GO:0042921 [glucocorticoid receptor signaling pathway] evidence: TAS
            GeneID:811 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS
            GeneID:811 -> Biological process: GO:0043687 [post-translational protein modification] evidence: TAS
            GeneID:811 -> Biological process: GO:0044267 [cellular protein metabolic process] evidence: TAS
            GeneID:811 -> Biological process: GO:0045665 [negative regulation of neuron differentiation] evidence: IDA
            GeneID:811 -> Biological process: GO:0045740 [positive regulation of DNA replication] evidence: IGI
            GeneID:811 -> Biological process: GO:0045787 [positive regulation of cell cycle] evidence: IGI
            GeneID:811 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: IDA
            GeneID:811 -> Biological process: GO:0048387 [negative regulation of retinoic acid receptor signaling pathway] evidence: IDA
            GeneID:811 -> Biological process: GO:0050766 [positive regulation of phagocytosis] evidence: ISS
            GeneID:811 -> Biological process: GO:0050821 [protein stabilization] evidence: ISS
            GeneID:811 -> Biological process: GO:0050821 [protein stabilization] evidence: TAS
            GeneID:811 -> Biological process: GO:0051208 [sequestering of calcium ion] evidence: TAS
            GeneID:811 -> Biological process: GO:0055007 [cardiac muscle cell differentiation] evidence: IEA
            GeneID:811 -> Biological process: GO:0071285 [cellular response to lithium ion] evidence: IEA
            GeneID:811 -> Biological process: GO:0090398 [cellular senescence] evidence: IGI
            GeneID:811 -> Biological process: GO:1900026 [positive regulation of substrate adhesion-dependent cell spreading] evidence: IMP
            GeneID:811 -> Biological process: GO:2000510 [positive regulation of dendritic cell chemotaxis] evidence: IMP
            GeneID:811 -> Cellular component: GO:0001669 [acrosomal vesicle] evidence: IEA
            GeneID:811 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
            GeneID:811 -> Cellular component: GO:0005578 [proteinaceous extracellular matrix] evidence: IEA
            GeneID:811 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA
            GeneID:811 -> Cellular component: GO:0005622 [intracellular] evidence: TAS
            GeneID:811 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:811 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
            GeneID:811 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: TAS
            GeneID:811 -> Cellular component: GO:0005788 [endoplasmic reticulum lumen] evidence: IDA
            GeneID:811 -> Cellular component: GO:0005788 [endoplasmic reticulum lumen] evidence: TAS
            GeneID:811 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: IEA
            GeneID:811 -> Cellular component: GO:0005829 [cytosol] evidence: IDA
            GeneID:811 -> Cellular component: GO:0005844 [polysome] evidence: ISS
            GeneID:811 -> Cellular component: GO:0009897 [external side of plasma membrane] evidence: IEA
            GeneID:811 -> Cellular component: GO:0009986 [cell surface] evidence: TAS
            GeneID:811 -> Cellular component: GO:0033018 [sarcoplasmic reticulum lumen] evidence: IEA
            GeneID:811 -> Cellular component: GO:0042824 [MHC class I peptide loading complex] evidence: ISS
            GeneID:811 -> Cellular component: GO:0048471 [perinuclear region of cytoplasm] evidence: IDA
            GeneID:811 -> Cellular component: GO:0071556 [integral to lumenal side of endoplasmic reticulum membrane] evidence: TAS
            GeneID:811 -> Cellular component: GO:0071682 [endocytic vesicle lumen] evidence: TAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.