2024-04-24 15:12:08, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004322 1240 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens BCL2-associated agonist of cell death (BAD), transcript variant 1, mRNA. ACCESSION NM_004322 VERSION NM_004322.3 GI:197116381 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1240) AUTHORS Tran,A.T., Cortens,J.P., Du,Q., Wilkins,J.A. and Coombs,K.M. TITLE Influenza virus induces apoptosis via BAD-mediated mitochondrial dysregulation JOURNAL J. Virol. 87 (2), 1049-1060 (2013) PUBMED 23135712 REMARK GeneRIF: These data indicate that influenza viruses carefully modulate the activation of the apoptotic pathway that is dependent on the regulatory function of BAD and that failure of apoptosis activation resulted in unproductive viral replication. REFERENCE 2 (bases 1 to 1240) AUTHORS Fischer,A., Schmid,B., Ellinghaus,D., Nothnagel,M., Gaede,K.I., Schurmann,M., Lipinski,S., Rosenstiel,P., Zissel,G., Hohne,K., Petrek,M., Kolek,V., Pabst,S., Grohe,C., Grunewald,J., Ronninger,M., Eklund,A., Padyukov,L., Gieger,C., Wichmann,H.E., Nebel,A., Franke,A., Muller-Quernheim,J., Hofmann,S. and Schreiber,S. TITLE A novel sarcoidosis risk locus for Europeans on chromosome 11q13.1 JOURNAL Am. J. Respir. Crit. Care Med. 186 (9), 877-885 (2012) PUBMED 22837380 REFERENCE 3 (bases 1 to 1240) AUTHORS Zimmerman,M.A., Rahman,N.T., Yang,D., Lahat,G., Lazar,A.J., Pollock,R.E., Lev,D. and Liu,K. TITLE Unphosphorylated STAT1 promotes sarcoma development through repressing expression of Fas and bad and conferring apoptotic resistance JOURNAL Cancer Res. 72 (18), 4724-4732 (2012) PUBMED 22805310 REMARK GeneRIF: RNAi-mediated silencing of STAT1 in soft tissue sarcoma (STS) cells was sufficient to increase expression of the apoptotic mediators Fas and Bad and to elevate the sensitivity of STS cells to Fas-mediated apoptosis REFERENCE 4 (bases 1 to 1240) AUTHORS Aranovich,A., Liu,Q., Collins,T., Geng,F., Dixit,S., Leber,B. and Andrews,D.W. TITLE Differences in the mechanisms of proapoptotic BH3 proteins binding to Bcl-XL and Bcl-2 quantified in live MCF-7 cells JOURNAL Mol. Cell 45 (6), 754-763 (2012) PUBMED 22464442 REMARK GeneRIF: mechanism of proapoptotic BH3 proteins Bad and Bid binding to Bcl-XL and Bcl-2 in breast cancer cells REFERENCE 5 (bases 1 to 1240) AUTHORS Qayyum,R., Snively,B.M., Ziv,E., Nalls,M.A., Liu,Y., Tang,W., Yanek,L.R., Lange,L., Evans,M.K., Ganesh,S., Austin,M.A., Lettre,G., Becker,D.M., Zonderman,A.B., Singleton,A.B., Harris,T.B., Mohler,E.R., Logsdon,B.A., Kooperberg,C., Folsom,A.R., Wilson,J.G., Becker,L.C. and Reiner,A.P. TITLE A meta-analysis and genome-wide association study of platelet count and mean platelet volume in african americans JOURNAL PLoS Genet. 8 (3), E1002491 (2012) PUBMED 22423221 REFERENCE 6 (bases 1 to 1240) AUTHORS Hsu,S.Y., Kaipia,A., Zhu,L. and Hsueh,A.J. TITLE Interference of BAD (Bcl-xL/Bcl-2-associated death promoter)-induced apoptosis in mammalian cells by 14-3-3 isoforms and P11 JOURNAL Mol. Endocrinol. 11 (12), 1858-1867 (1997) PUBMED 9369453 REFERENCE 7 (bases 1 to 1240) AUTHORS Zha,J., Harada,H., Osipov,K., Jockel,J., Waksman,G. and Korsmeyer,S.J. TITLE BH3 domain of BAD is required for heterodimerization with BCL-XL and pro-apoptotic activity JOURNAL J. Biol. Chem. 272 (39), 24101-24104 (1997) PUBMED 9305851 REFERENCE 8 (bases 1 to 1240) AUTHORS Wang,H.G., Rapp,U.R. and Reed,J.C. TITLE Bcl-2 targets the protein kinase Raf-1 to mitochondria JOURNAL Cell 87 (4), 629-638 (1996) PUBMED 8929532 REFERENCE 9 (bases 1 to 1240) AUTHORS Zha,J., Harada,H., Yang,E., Jockel,J. and Korsmeyer,S.J. TITLE Serine phosphorylation of death agonist BAD in response to survival factor results in binding to 14-3-3 not BCL-X(L) JOURNAL Cell 87 (4), 619-628 (1996) PUBMED 8929531 REFERENCE 10 (bases 1 to 1240) AUTHORS Yang,E., Zha,J., Jockel,J., Boise,L.H., Thompson,C.B. and Korsmeyer,S.J. TITLE Bad, a heterodimeric partner for Bcl-XL and Bcl-2, displaces Bax and promotes cell death JOURNAL Cell 80 (2), 285-291 (1995) PUBMED 7834748 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK291863.1, BG435829.1, BE255791.1, BC001901.2 and AW014069.1. On Aug 21, 2008 this sequence version replaced gi:14670386. Summary: The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (1) represents the longer transcript. Variants 1 and 2 both encode the same protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: U66879.1, BM560839.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025088 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-65 AK291863.1 1-65 66-95 BG435829.1 2-31 96-621 BE255791.1 1-526 622-1219 BC001901.2 294-891 1220-1240 AW014069.1 1-21 c FEATURES Location/Qualifiers source 1..1240 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="11" /map="11q13.1" gene 1..1240 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /note="BCL2-associated agonist of cell death" /db_xref="GeneID:572" /db_xref="HGNC:936" /db_xref="HPRD:04409" /db_xref="MIM:603167" exon 1..523 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /inference="alignment:Splign:1.39.8" misc_feature 310..312 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /note="upstream in-frame stop codon" CDS 337..843 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /note="BCL2-binding protein; BCL2-binding component 6; BCL-X/BCL-2 binding protein; BCL2-antagonist of cell death protein; bcl2-L-8; bcl-2-like protein 8; bcl-2-binding component 6; bcl-XL/Bcl-2-associated death promoter" /codon_start=1 /product="bcl2 antagonist of cell death" /protein_id="NP_004313.1" /db_xref="GI:10835069" /db_xref="CCDS:CCDS8065.1" /db_xref="GeneID:572" /db_xref="HGNC:936" /db_xref="HPRD:04409" /db_xref="MIM:603167" /translation="
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
" misc_feature 337..840 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /note="Pro-apoptotic Bcl-2 protein, BAD; Region: Bcl-2_BAD; pfam10514" /db_xref="CDD:119034" misc_feature 559..561 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="dephosphorylation site; modified site" /db_xref="HPRD:00234" misc_feature 559..561 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:03402" misc_feature 559..561 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:03403" misc_feature 559..561 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:06423" misc_feature 559..561 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01261" misc_feature 559..561 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01292" misc_feature 559..561 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:02244" misc_feature 559..561 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:15137" misc_feature 607..609 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (Q92934.3); phosphorylation site" misc_feature 616..618 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="Asymmetric dimethylarginine, by PRMT1; propagated from UniProtKB/Swiss-Prot (Q92934.3); methylation site" misc_feature 622..624 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="Asymmetric dimethylarginine, by PRMT1; propagated from UniProtKB/Swiss-Prot (Q92934.3); methylation site" misc_feature 631..633 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="dephosphorylation site; modified site" /db_xref="HPRD:00234" misc_feature 631..633 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine, by PKB/AKT1, alternate; propagated from UniProtKB/Swiss-Prot (Q92934.3); phosphorylation site" misc_feature 631..633 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01261" misc_feature 631..633 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01292" misc_feature 631..633 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:02244" misc_feature 631..633 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:15137" misc_feature 664..708 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q92934.3); Region: BH3" misc_feature 688..690 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (Q92934.3); phosphorylation site" misc_feature 688..690 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:03382" misc_feature 688..690 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:03402" misc_feature 688..690 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:03403" misc_feature 688..690 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01261" misc_feature 688..690 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01292" misc_feature 688..690 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:02244" misc_feature 688..690 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:15137" misc_feature 736..738 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" misc_feature 793..795 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:03382" misc_feature 793..795 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:03402" misc_feature 793..795 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:06789" variation 478 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /replace="g" /replace="t" /db_xref="dbSNP:11541683" exon 524..714 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /inference="alignment:Splign:1.39.8" variation 624 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /replace="c" /replace="t" /db_xref="dbSNP:2286615" variation 655 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /replace="g" /replace="t" /db_xref="dbSNP:3729933" variation 663 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:2286616" exon 715..1224 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /inference="alignment:Splign:1.39.8" STS 715..975 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /standard_name="PMC230316P4" /db_xref="UniSTS:272182" variation 788 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /replace="c" /replace="t" /db_xref="dbSNP:15934" STS 835..968 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /standard_name="RH78541" /db_xref="UniSTS:66632" STS 850..1040 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /standard_name="RH80230" /db_xref="UniSTS:87698" STS 948..1134 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /standard_name="SHGC-64070" /db_xref="UniSTS:76204" STS 951..1198 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /standard_name="RH80521" /db_xref="UniSTS:83919" variation 1113 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /replace="c" /replace="t" /db_xref="dbSNP:1050029" variation 1117 /gene="BAD" /gene_synonym="BBC2; BCL2L8" /replace="a" /replace="g" /db_xref="dbSNP:10556" polyA_signal 1199..1204 /gene="BAD" /gene_synonym="BBC2; BCL2L8" polyA_site 1224 /gene="BAD" /gene_synonym="BBC2; BCL2L8" ORIGIN
aactagggcccggagcccggggtgctggagggaggcggcaggcccgggtcaggggcctcgagatcgggcttggggtgagacctgtgcgccgtcaccacgggcggggcggggcctgggtccaccggggttctgaggggagactgaggtcctgagccgacagcctcagctccctgccaggccagacccggcagacagatgagggcccaggaggcctggcgggcctgggggcgctacggtgggagaggaagccaggggtacctgcctctgccttccagggccaccgttggccccagctgtgccttgactacgtaacatcttgtcctcacagcccagagcatgttccagatcccagagtttgagccgagtgagcaggaagactccagctctgcagagaggggcctgggccccagccccgcaggggacgggccctcaggctccggcaagcatcatcgccaggccccaggcctcctgtgggacgccagtcaccagcaggagcagccaaccagcagcagccatcatggaggcgctggggctgtggagatccggagtcgccacagctcctaccccgcggggacggaggacgacgaagggatgggggaggagcccagcccctttcggggccgctcgcgctcggcgccccccaacctctgggcagcacagcgctatggccgcgagctccggaggatgagtgacgagtttgtggactcctttaagaagggacttcctcgcccgaagagcgcgggcacagcaacgcagatgcggcaaagctccagctggacgcgagtcttccagtcctggtgggatcggaacttgggcaggggaagctccgccccctcccagtgaccttcgctccacatcccgaaactccacccgttcccactgccctgggcagccatcttgaatatgggcggaagtacttccctcaggcctatgcaaaaagaggatccgtgctgtctcctttggagggagggctgacccagattcccttccggtgcgtgtgaagccacggaaggcttggtcccatcggaagttttgggttttccgcccacagccgccggaagtggctccgtggccccgccctcaggctccgggctttcccccaggcgcctgcgctaagtcgcgagccaggtttaaccgttgcgtcaccgggacccgagcccccgcgatgccctgggggccgtgctcactaccaaatgttaataaagcccgcgtctgtgccgccgaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:572 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:572 -> Molecular function: GO:0005543 [phospholipid binding] evidence: IMP GeneID:572 -> Molecular function: GO:0008289 [lipid binding] evidence: IDA GeneID:572 -> Molecular function: GO:0008656 [cysteine-type endopeptidase activator activity involved in apoptotic process] evidence: IDA GeneID:572 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI GeneID:572 -> Molecular function: GO:0030346 [protein phosphatase 2B binding] evidence: IEA GeneID:572 -> Molecular function: GO:0043422 [protein kinase B binding] evidence: IEA GeneID:572 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IEA GeneID:572 -> Biological process: GO:0006007 [glucose catabolic process] evidence: IEA GeneID:572 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:572 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IDA GeneID:572 -> Biological process: GO:0006919 [activation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: ISS GeneID:572 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS GeneID:572 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: TAS GeneID:572 -> Biological process: GO:0009749 [response to glucose stimulus] evidence: IEA GeneID:572 -> Biological process: GO:0010508 [positive regulation of autophagy] evidence: TAS GeneID:572 -> Biological process: GO:0010918 [positive regulation of mitochondrial membrane potential] evidence: ISS GeneID:572 -> Biological process: GO:0019221 [cytokine-mediated signaling pathway] evidence: IEA GeneID:572 -> Biological process: GO:0032024 [positive regulation of insulin secretion] evidence: ISS GeneID:572 -> Biological process: GO:0032355 [response to estradiol stimulus] evidence: IEA GeneID:572 -> Biological process: GO:0032570 [response to progesterone stimulus] evidence: IEA GeneID:572 -> Biological process: GO:0033133 [positive regulation of glucokinase activity] evidence: ISS GeneID:572 -> Biological process: GO:0033574 [response to testosterone stimulus] evidence: IEA GeneID:572 -> Biological process: GO:0034201 [response to oleic acid] evidence: IEA GeneID:572 -> Biological process: GO:0035774 [positive regulation of insulin secretion involved in cellular response to glucose stimulus] evidence: IEA GeneID:572 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS GeneID:572 -> Biological process: GO:0042493 [response to drug] evidence: IEA GeneID:572 -> Biological process: GO:0042542 [response to hydrogen peroxide] evidence: IEA GeneID:572 -> Biological process: GO:0042593 [glucose homeostasis] evidence: ISS GeneID:572 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IDA GeneID:572 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IMP GeneID:572 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: TAS GeneID:572 -> Biological process: GO:0043200 [response to amino acid stimulus] evidence: IEA GeneID:572 -> Biological process: GO:0043280 [positive regulation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IDA GeneID:572 -> Biological process: GO:0044342 [type B pancreatic cell proliferation] evidence: ISS GeneID:572 -> Biological process: GO:0045087 [innate immune response] evidence: TAS GeneID:572 -> Biological process: GO:0045471 [response to ethanol] evidence: IEA GeneID:572 -> Biological process: GO:0045579 [positive regulation of B cell differentiation] evidence: IEA GeneID:572 -> Biological process: GO:0045582 [positive regulation of T cell differentiation] evidence: IEA GeneID:572 -> Biological process: GO:0045862 [positive regulation of proteolysis] evidence: IDA GeneID:572 -> Biological process: GO:0046031 [ADP metabolic process] evidence: ISS GeneID:572 -> Biological process: GO:0046034 [ATP metabolic process] evidence: ISS GeneID:572 -> Biological process: GO:0046902 [regulation of mitochondrial membrane permeability] evidence: IMP GeneID:572 -> Biological process: GO:0046931 [pore complex assembly] evidence: IDA GeneID:572 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS GeneID:572 -> Biological process: GO:0048015 [phosphatidylinositol-mediated signaling] evidence: TAS GeneID:572 -> Biological process: GO:0050679 [positive regulation of epithelial cell proliferation] evidence: IMP GeneID:572 -> Biological process: GO:0051384 [response to glucocorticoid stimulus] evidence: IEA GeneID:572 -> Biological process: GO:0051592 [response to calcium ion] evidence: IEA GeneID:572 -> Biological process: GO:0060154 [cellular process regulating host cell cycle in response to virus] evidence: IEA GeneID:572 -> Biological process: GO:0071247 [cellular response to chromate] evidence: IEA GeneID:572 -> Biological process: GO:0071260 [cellular response to mechanical stimulus] evidence: IEP GeneID:572 -> Biological process: GO:0071316 [cellular response to nicotine] evidence: IDA GeneID:572 -> Biological process: GO:0071396 [cellular response to lipid] evidence: IEA GeneID:572 -> Biological process: GO:0071456 [cellular response to hypoxia] evidence: IEP GeneID:572 -> Biological process: GO:0090200 [positive regulation of release of cytochrome c from mitochondria] evidence: IMP GeneID:572 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: TAS GeneID:572 -> Biological process: GO:0097191 [extrinsic apoptotic signaling pathway] evidence: IMP GeneID:572 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: IMP GeneID:572 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS GeneID:572 -> Biological process: GO:0097202 [activation of cysteine-type endopeptidase activity] evidence: IDA GeneID:572 -> Biological process: GO:1900740 [positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: TAS GeneID:572 -> Biological process: GO:2000078 [positive regulation of type B pancreatic cell development] evidence: ISS GeneID:572 -> Biological process: GO:2001244 [positive regulation of intrinsic apoptotic signaling pathway] evidence: TAS GeneID:572 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA GeneID:572 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: IDA GeneID:572 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: TAS GeneID:572 -> Cellular component: GO:0005829 [cytosol] evidence: IDA GeneID:572 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.