2024-04-25 19:03:41, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004143 1251 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 1, mRNA. ACCESSION NM_004143 VERSION NM_004143.3 GI:222136685 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1251) AUTHORS Murphy,A.J., Pierce,J., de Caestecker,C., Taylor,C., Anderson,J.R., Perantoni,A.O., de Caestecker,M.P. and Lovvorn,H.N. III. TITLE SIX2 and CITED1, markers of nephronic progenitor self-renewal, remain active in primitive elements of Wilms' tumor JOURNAL J. Pediatr. Surg. 47 (6), 1239-1249 (2012) PUBMED 22703800 REMARK GeneRIF: CITED1 expression remains active across all disease characteristics of Wilms tumor. It is found in the nucleus & cytosol. It is not found in normal kidney. REFERENCE 2 (bases 1 to 1251) AUTHORS Sassa,M., Hayashi,Y., Watanabe,R., Kikumori,T., Imai,T., Kurebayashi,J., Kiuchi,T. and Murata,Y. TITLE Aberrant promoter methylation in overexpression of CITED1 in papillary thyroid cancer JOURNAL Thyroid 21 (5), 511-517 (2011) PUBMED 21449767 REMARK GeneRIF: epigenetic regulation is involved in the overexpression of CITED1 in papillary thyroid cancer REFERENCE 3 (bases 1 to 1251) AUTHORS Dittmer,S., Kovacs,Z., Yuan,S.H., Siszler,G., Kogl,M., Summer,H., Geerts,A., Golz,S., Shioda,T. and Methner,A. TITLE TOX3 is a neuronal survival factor that induces transcription depending on the presence of CITED1 or phosphorylated CREB in the transcriptionally active complex JOURNAL J. Cell. Sci. 124 (PT 2), 252-260 (2011) PUBMED 21172805 REMARK GeneRIF: TOX3 induces transcription in neuron depending on the presence of CITED1 or phosphorylated CREB in the transcriptionally active complex. REFERENCE 4 (bases 1 to 1251) AUTHORS Dillon,R.L., Brown,S.T., Ling,C., Shioda,T. and Muller,W.J. TITLE An EGR2/CITED1 transcription factor complex and the 14-3-3sigma tumor suppressor are involved in regulating ErbB2 expression in a transgenic-mouse model of human breast cancer JOURNAL Mol. Cell. Biol. 27 (24), 8648-8657 (2007) PUBMED 17938205 REFERENCE 5 (bases 1 to 1251) AUTHORS Vachtenheim,J. and Novotna,H. TITLE Expression of genes for microphthalmia isoforms, Pax3 and MSG1, in human melanomas JOURNAL Cell. Mol. Biol. (Noisy-le-grand) 45 (7), 1075-1082 (1999) PUBMED 10644012 REFERENCE 6 (bases 1 to 1251) AUTHORS Shioda,T., Lechleider,R.J., Dunwoodie,S.L., Li,H., Yahata,T., de Caestecker,M.P., Fenner,M.H., Roberts,A.B. and Isselbacher,K.J. TITLE Transcriptional activating activity of Smad4: roles of SMAD hetero-oligomerization and enhancement by an associating transactivator JOURNAL Proc. Natl. Acad. Sci. U.S.A. 95 (17), 9785-9790 (1998) PUBMED 9707553 REFERENCE 7 (bases 1 to 1251) AUTHORS Fenner,M.H., Parrish,J.E., Boyd,Y., Reed,V., MacDonald,M., Nelson,D.L., Isselbacher,K.J. and Shioda,T. TITLE MSG1 (melanocyte-specific gene 1): mapping to chromosome Xq13.1, genomic organization, and promoter analysis JOURNAL Genomics 51 (3), 401-407 (1998) PUBMED 9721210 REFERENCE 8 (bases 1 to 1251) AUTHORS Li,H., Ahmed,N.U., Fenner,M.H., Ueda,M., Isselbacher,K.J. and Shioda,T. TITLE Regulation of expression of MSG1 melanocyte-specific nuclear protein in human melanocytes and melanoma cells JOURNAL Exp. Cell Res. 242 (2), 478-486 (1998) PUBMED 9683535 REFERENCE 9 (bases 1 to 1251) AUTHORS Shioda,T., Fenner,M.H. and Isselbacher,K.J. TITLE MSG1 and its related protein MRG1 share a transcription activating domain JOURNAL Gene 204 (1-2), 235-241 (1997) PUBMED 9434189 REFERENCE 10 (bases 1 to 1251) AUTHORS Shioda,T., Fenner,M.H. and Isselbacher,K.J. TITLE msg1, a novel melanocyte-specific gene, encodes a nuclear protein and is associated with pigmentation JOURNAL Proc. Natl. Acad. Sci. U.S.A. 93 (22), 12298-12303 (1996) PUBMED 8901575 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL135749.3, BC004240.1 and AI217516.1. This sequence is a reference standard in the RefSeqGene project. On Jan 29, 2009 this sequence version replaced gi:20127458. Summary: This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]. Transcript Variant: This variant (1) represents the longest transcript and encodes the shorter isoform (1). Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BI668290.1, BC004240.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025082, ERS025085 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-47 AL135749.3 120830-120876 c 48-863 BC004240.1 1-816 864-864 AL135749.3 115906-115906 c 865-1231 BC004240.1 818-1184 1232-1251 AI217516.1 1-20 c FEATURES Location/Qualifiers source 1..1251 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="X" /map="Xq13.1" gene 1..1251 /gene="CITED1" /gene_synonym="MSG1" /note="Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1" /db_xref="GeneID:4435" /db_xref="HGNC:1986" /db_xref="MIM:300149" exon 1..511 /gene="CITED1" /gene_synonym="MSG1" /inference="alignment:Splign:1.39.8" misc_feature 385..387 /gene="CITED1" /gene_synonym="MSG1" /note="upstream in-frame stop codon" exon 512..636 /gene="CITED1" /gene_synonym="MSG1" /inference="alignment:Splign:1.39.8" CDS 577..1158 /gene="CITED1" /gene_synonym="MSG1" /note="isoform 1 is encoded by transcript variant 1; melanocyte-specific gene 1; melanocyte-specific protein 1" /codon_start=1 /product="cbp/p300-interacting transactivator 1 isoform 1" /protein_id="NP_004134.2" /db_xref="GI:222136686" /db_xref="CCDS:CCDS14419.1" /db_xref="GeneID:4435" /db_xref="HGNC:1986" /db_xref="MIM:300149" /translation="
MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMHLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
" misc_feature 577..1149 /gene="CITED1" /gene_synonym="MSG1" /note="CITED; Region: CITED; pfam04487" /db_xref="CDD:146896" misc_feature 1048..1077 /gene="CITED1" /gene_synonym="MSG1" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q99966.2); Region: Nuclear export signal" exon 637..1243 /gene="CITED1" /gene_synonym="MSG1" /inference="alignment:Splign:1.39.8" variation 864 /gene="CITED1" /gene_synonym="MSG1" /replace="c" /replace="g" /db_xref="dbSNP:3012627" variation 933 /gene="CITED1" /gene_synonym="MSG1" /replace="a" /replace="g" /db_xref="dbSNP:1804686" variation 942 /gene="CITED1" /gene_synonym="MSG1" /replace="a" /replace="t" /db_xref="dbSNP:13669" STS 1045..1182 /gene="CITED1" /gene_synonym="MSG1" /standard_name="RH35925" /db_xref="UniSTS:36969" STS 1075..1203 /gene="CITED1" /gene_synonym="MSG1" /standard_name="SGC35157" /db_xref="UniSTS:7742" variation 1193 /gene="CITED1" /gene_synonym="MSG1" /replace="a" /replace="c" /db_xref="dbSNP:1047458" polyA_signal 1214..1219 /gene="CITED1" /gene_synonym="MSG1" polyA_site 1243 /gene="CITED1" /gene_synonym="MSG1" ORIGIN
acgagccaggacatgtgctaataatgccctaagccggttataaagacgtggaaattgaggggagaaaaaaaaagggaaaaaaagggtctgtccttcctgggattcctagccgaggccagtctgctgccgtgtgcgtgtgcgtcagggctctccgggcggcaatgggggcttgagagccgggtccccagcgccgggaagggagcgcggtggccgccaccgccaccgccccggagtccggcgccgaagctgcgggcgggcgggcgggcaccagctcggtcaggggctgcttggcgcggcactgtgcggtgcagcggcggcgcggcgcggtgcgggcttttcccaggcgccccggggtcgggtggccaacggcgcggccgcgggcgctgagcgcgaccggttcgcggtagcggtggcggcggcgtgcgtgccaggggctgggggctccgccgcctctcttgcggctcaccgagctccgcgcttccctctctccagggcaggcggcttctcagagcacaacagctccagctggcagcatcacttcccgccaatttatccaacttctgccaaggctctgaaatgccaacaacgtcgaggcctgcacttgatgtcaagggtggcacctcacctgcgaaggaggatgccaaccaagagatgagctccgtggcctactccaaccttgcggtgaaagatcgcaaagcagtggccattctgcactaccctggggtagcctcaaatggaaccaaggccagtggggctcccactagttcctcgggatctccaataggctctcctacaaccacccctcccactaaacccccatccttcaacctgcaccccgcccctcacttgctggctagtatgcacctgcagaaacttaatagccagtatcaggggatggctgctgccactccaggccaacccggggaggcaggacccctgcaaaactgggactttggggcccaggcgggaggggcagaatcactctctccttctgctggtgcccagagccctgctatcatcgattcggacccagtggatgaggaagtgctgatgtcgctggtggtggaactggggttggaccgagccaatgagcttccggagctgtggctggggcagaatgagtttgacttcactgcggactttccatctagctgctaatgccaagtgtccctaaagatggaggaataaagccaccaattctgttgtaaataaaaataaagttacttacaaagagacgggccaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:4435 -> Molecular function: GO:0003682 [chromatin binding] evidence: ISS GeneID:4435 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: NAS GeneID:4435 -> Molecular function: GO:0003713 [transcription coactivator activity] evidence: IDA GeneID:4435 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:4435 -> Molecular function: GO:0008022 [protein C-terminus binding] evidence: IPI GeneID:4435 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IDA GeneID:4435 -> Molecular function: GO:0044212 [transcription regulatory region DNA binding] evidence: IDA GeneID:4435 -> Molecular function: GO:0050693 [LBD domain binding] evidence: IDA GeneID:4435 -> Molecular function: GO:0070410 [co-SMAD binding] evidence: IPI GeneID:4435 -> Biological process: GO:0000578 [embryonic axis specification] evidence: IEA GeneID:4435 -> Biological process: GO:0001570 [vasculogenesis] evidence: IEA GeneID:4435 -> Biological process: GO:0001656 [metanephros development] evidence: TAS GeneID:4435 -> Biological process: GO:0001658 [branching involved in ureteric bud morphogenesis] evidence: ISS GeneID:4435 -> Biological process: GO:0001890 [placenta development] evidence: ISS GeneID:4435 -> Biological process: GO:0003340 [negative regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis] evidence: IEA GeneID:4435 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA GeneID:4435 -> Biological process: GO:0006357 [regulation of transcription from RNA polymerase II promoter] evidence: TAS GeneID:4435 -> Biological process: GO:0006913 [nucleocytoplasmic transport] evidence: IDA GeneID:4435 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:4435 -> Biological process: GO:0007179 [transforming growth factor beta receptor signaling pathway] evidence: IDA GeneID:4435 -> Biological process: GO:0007420 [brain development] evidence: IEA GeneID:4435 -> Biological process: GO:0008283 [cell proliferation] evidence: TAS GeneID:4435 -> Biological process: GO:0010628 [positive regulation of gene expression] evidence: ISS GeneID:4435 -> Biological process: GO:0030178 [negative regulation of Wnt receptor signaling pathway] evidence: TAS GeneID:4435 -> Biological process: GO:0030318 [melanocyte differentiation] evidence: IMP GeneID:4435 -> Biological process: GO:0030511 [positive regulation of transforming growth factor beta receptor signaling pathway] evidence: TAS GeneID:4435 -> Biological process: GO:0032496 [response to lipopolysaccharide] evidence: ISS GeneID:4435 -> Biological process: GO:0032868 [response to insulin stimulus] evidence: ISS GeneID:4435 -> Biological process: GO:0034097 [response to cytokine stimulus] evidence: ISS GeneID:4435 -> Biological process: GO:0034341 [response to interferon-gamma] evidence: ISS GeneID:4435 -> Biological process: GO:0042438 [melanin biosynthetic process] evidence: ISS GeneID:4435 -> Biological process: GO:0043473 [pigmentation] evidence: IMP GeneID:4435 -> Biological process: GO:0043524 [negative regulation of neuron apoptotic process] evidence: IDA GeneID:4435 -> Biological process: GO:0043627 [response to estrogen stimulus] evidence: IDA GeneID:4435 -> Biological process: GO:0043627 [response to estrogen stimulus] evidence: TAS GeneID:4435 -> Biological process: GO:0045668 [negative regulation of osteoblast differentiation] evidence: ISS GeneID:4435 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: IDA GeneID:4435 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: ISS GeneID:4435 -> Biological process: GO:0045893 [positive regulation of transcription, DNA-dependent] evidence: IDA GeneID:4435 -> Biological process: GO:0051591 [response to cAMP] evidence: ISS GeneID:4435 -> Biological process: GO:0060231 [mesenchymal to epithelial transition] evidence: TAS GeneID:4435 -> Biological process: GO:0060395 [SMAD protein signal transduction] evidence: IDA GeneID:4435 -> Biological process: GO:0060711 [labyrinthine layer development] evidence: IEA GeneID:4435 -> Biological process: GO:0060712 [spongiotrophoblast layer development] evidence: IEA GeneID:4435 -> Biological process: GO:0070555 [response to interleukin-1] evidence: ISS GeneID:4435 -> Biological process: GO:0070669 [response to interleukin-2] evidence: ISS GeneID:4435 -> Biological process: GO:0070670 [response to interleukin-4] evidence: ISS GeneID:4435 -> Biological process: GO:0070741 [response to interleukin-6] evidence: ISS GeneID:4435 -> Biological process: GO:0071104 [response to interleukin-9] evidence: ISS GeneID:4435 -> Biological process: GO:0071105 [response to interleukin-11] evidence: ISS GeneID:4435 -> Biological process: GO:0071107 [response to parathyroid hormone stimulus] evidence: ISS GeneID:4435 -> Biological process: GO:0071559 [response to transforming growth factor beta stimulus] evidence: IDA GeneID:4435 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:4435 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA GeneID:4435 -> Cellular component: GO:0005829 [cytosol] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.