2024-04-19 02:38:22, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004131 941 bp mRNA linear PRI 15-JUL-2013 DEFINITION Homo sapiens granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) (GZMB), mRNA. ACCESSION NM_004131 VERSION NM_004131.4 GI:221625527 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 941) AUTHORS Cao,Y., Pan,Y., Huang,H., Jin,X., Levin,E.J., Kloss,B. and Zhou,M. TITLE Gating of the TrkH ion channel by its associated RCK protein TrkA JOURNAL Nature 496 (7445), 317-322 (2013) PUBMED 23598339 REMARK GeneRIF: results suggest a mechanism for how ATP increases TrkH activity by inducing conformational changes in TrkA REFERENCE 2 (bases 1 to 941) AUTHORS Karrich,J.J., Jachimowski,L.C., Nagasawa,M., Kamp,A., Balzarolo,M., Wolkers,M.C., Uittenbogaart,C.H., Marieke van Ham,S. and Blom,B. TITLE IL-21-stimulated human plasmacytoid dendritic cells secrete granzyme B, which impairs their capacity to induce T-cell proliferation JOURNAL Blood 121 (16), 3103-3111 (2013) PUBMED 23407551 REMARK GeneRIF: IL-21-induced granzyme B production by plasmacytoid dendritic cells inhibits T-cell proliferation. REFERENCE 3 (bases 1 to 941) AUTHORS Lopez,J.A., Susanto,O., Jenkins,M.R., Lukoyanova,N., Sutton,V.R., Law,R.H., Johnston,A., Bird,C.H., Bird,P.I., Whisstock,J.C., Trapani,J.A., Saibil,H.R. and Voskoboinik,I. TITLE Perforin forms transient pores on the target cell plasma membrane to facilitate rapid access of granzymes during killer cell attack JOURNAL Blood 121 (14), 2659-2668 (2013) PUBMED 23377437 REMARK GeneRIF: This study defines the final sequence of events controlling cytotoxic lymphocyte immune defense, in which perforin pores assemble on the target cell plasma membrane, ensuring efficient delivery of lethal granzymes. REFERENCE 4 (bases 1 to 941) AUTHORS Knevel,R., Krabben,A., Wilson,A.G., Brouwer,E., Leijsma,M.K., Lindqvist,E., de Rooy,D.P., Daha,N.A., van der Linden,M.P., Tsonaka,S., Zhernakova,A., Westra,H.J., Franke,L., Houwing-Duistermaat,J.J., Toes,R.E., Huizinga,T.W., Saxne,T. and van der Helm-van Mil,A.H. TITLE A genetic variant in granzyme B is associated with progression of joint destruction in rheumatoid arthritis JOURNAL Arthritis Rheum. 65 (3), 582-589 (2013) PUBMED 23440692 REMARK GeneRIF: Single nucleotide polymorphism rs8192916 located in GZMB is associated with the progression of joint destruction in rheumatoid arthritis as well as with RNA expression in whole blood. REFERENCE 5 (bases 1 to 941) AUTHORS Spencer,C.T., Abate,G., Sakala,I.G., Xia,M., Truscott,S.M., Eickhoff,C.S., Linn,R., Blazevic,A., Metkar,S.S., Peng,G., Froelich,C.J. and Hoft,D.F. TITLE Granzyme A produced by gamma(9)delta(2) T cells induces human macrophages to inhibit growth of an intracellular pathogen JOURNAL PLoS Pathog. 9 (1), E1003119 (2013) PUBMED 23326234 REMARK GeneRIF: Granzyme A produced by gamma(9)delta(2) T cells induces human macrophages to inhibit growth of an intracellular pathogen. REFERENCE 6 (bases 1 to 941) AUTHORS Poe,M., Blake,J.T., Boulton,D.A., Gammon,M., Sigal,N.H., Wu,J.K. and Zweerink,H.J. TITLE Human cytotoxic lymphocyte granzyme B. Its purification from granules and the characterization of substrate and inhibitor specificity JOURNAL J. Biol. Chem. 266 (1), 98-103 (1991) PUBMED 1985927 REFERENCE 7 (bases 1 to 941) AUTHORS Haddad,P., Jenne,D., Tschopp,J., Clement,M.V., Mathieu-Mahul,D. and Sasportes,M. TITLE Structure and evolutionary origin of the human granzyme H gene JOURNAL Int. Immunol. 3 (1), 57-66 (1991) PUBMED 2049336 REFERENCE 8 (bases 1 to 941) AUTHORS Meier,M., Kwong,P.C., Fregeau,C.J., Atkinson,E.A., Burrington,M., Ehrman,N., Sorensen,O., Lin,C.C., Wilkins,J. and Bleackley,R.C. TITLE Cloning of a gene that encodes a new member of the human cytotoxic cell protease family JOURNAL Biochemistry 29 (17), 4042-4049 (1990) PUBMED 2193684 REFERENCE 9 (bases 1 to 941) AUTHORS Hanson,R.D., Hohn,P.A., Popescu,N.C. and Ley,T.J. TITLE A cluster of hematopoietic serine protease genes is found on the same chromosomal band as the human alpha/delta T-cell receptor locus JOURNAL Proc. Natl. Acad. Sci. U.S.A. 87 (3), 960-963 (1990) PUBMED 2300587 REFERENCE 10 (bases 1 to 941) AUTHORS Kopp,S. TITLE Reproducibility of response to a questionnaire on symptoms of masticatory dysfunction JOURNAL Community Dent Oral Epidemiol 4 (5), 205-209 (1976) PUBMED 1067155 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AY372494.1, BX283601.1 and CB528665.1. This sequence is a reference standard in the RefSeqGene project. On Jan 27, 2009 this sequence version replaced gi:32483414. Summary: Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein encoded by this gene is crucial for the rapid induction of target cell apoptosis by CTL in cell-mediated immune response. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BM561748.1, AY372494.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025088 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-229 AY372494.1 42-270 230-305 BX283601.1 232-307 306-910 AY372494.1 347-951 911-941 CB528665.1 1-31 c FEATURES Location/Qualifiers source 1..941 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="14" /map="14q11.2" gene 1..941 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /note="granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1)" /db_xref="GeneID:3002" /db_xref="HGNC:4709" /db_xref="MIM:123910" exon 1..121 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /inference="alignment:Splign:1.39.8" CDS 67..810 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /EC_number="3.4.21.79" /note="fragmentin 2; cathepsin G-like 1; T-cell serine protease 1-3E; cytotoxic serine protease B; C11; CTLA-1; fragmentin-2; human lymphocyte protein; cytotoxic T-lymphocyte proteinase 2" /codon_start=1 /product="granzyme B precursor" /protein_id="NP_004122.2" /db_xref="GI:221625528" /db_xref="CCDS:CCDS9633.1" /db_xref="GeneID:3002" /db_xref="HGNC:4709" /db_xref="MIM:123910" /translation="
MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
" sig_peptide 67..126 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" mat_peptide 127..807 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /product="granzyme B" misc_feature 127..795 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /note="Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cd00190" /db_xref="CDD:29152" misc_feature 127..129 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /note="cleavage site" /db_xref="CDD:29152" misc_feature order(256..258,388..390,673..675) /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /note="active site" /db_xref="CDD:29152" misc_feature order(655..657,718..720,724..726) /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:29152" misc_feature 748..750 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /inference="non-experimental evidence, no additional details recorded" /note="Mediates preference for Asp-containing substrates (By similarity); propagated from UniProtKB/Swiss-Prot (P10144.2); other site" exon 122..269 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /inference="alignment:Splign:1.39.8" variation 230 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /replace="a" /replace="g" /db_xref="dbSNP:8192917" exon 270..405 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /inference="alignment:Splign:1.39.8" STS 291..629 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /standard_name="PMC60854P1" /db_xref="UniSTS:273405" variation 306 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /replace="a" /replace="g" /db_xref="dbSNP:10909625" variation 346 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /replace="c" /replace="g" /db_xref="dbSNP:11539752" variation 387 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /replace="c" /replace="t" /db_xref="dbSNP:1126639" exon 406..666 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /inference="alignment:Splign:1.39.8" exon 667..927 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /inference="alignment:Splign:1.39.8" STS 832..912 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" /standard_name="D14S1256" /db_xref="UniSTS:31851" polyA_signal 900..905 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" polyA_site 927 /gene="GZMB" /gene_synonym="CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT" ORIGIN
ccaagagctaaaagagagcaaggaggaaacaacagcagctccaaccagggcagccttcctgagaagatgcaaccaatcctgcttctgctggccttcctcctgctgcccagggcagatgcaggggagatcatcgggggacatgaggccaagccccactcccgcccctacatggcttatcttatgatctgggatcagaagtctctgaagaggtgcggtggcttcctgatacgagacgacttcgtgctgacagctgctcactgttggggaagctccataaatgtcaccttgggggcccacaatatcaaagaacaggagccgacccagcagtttatccctgtgaaaagacccatcccccatccagcctataatcctaagaacttctccaacgacatcatgctactgcagctggagagaaaggccaagcggaccagagctgtgcagcccctcaggctacctagcaacaaggcccaggtgaagccagggcagacatgcagtgtggccggctgggggcagacggcccccctgggaaaacactcacacacactacaagaggtgaagatgacagtgcaggaagatcgaaagtgcgaatctgacttacgccattattacgacagtaccattgagttgtgcgtgggggacccagagattaaaaagacttcctttaagggggactctggaggccctcttgtgtgtaacaaggtggcccagggcattgtctcctatggacgaaacaatggcatgcctccacgagcctgcaccaaagtctcaagctttgtacactggataaagaaaaccatgaaacgctactaactacaggaagcaaactaagcccccgctgtaatgaaacaccttctctggagccaagtccagatttacactgggagaggtgccagcaactgaataaatacctcttagctgagtggaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:3002 -> Molecular function: GO:0004252 [serine-type endopeptidase activity] evidence: TAS GeneID:3002 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:3002 -> Molecular function: GO:0008236 [serine-type peptidase activity] evidence: TAS GeneID:3002 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:3002 -> Biological process: GO:0006922 [cleavage of lamin involved in execution phase of apoptosis] evidence: IDA GeneID:3002 -> Biological process: GO:0007219 [Notch signaling pathway] evidence: TAS GeneID:3002 -> Biological process: GO:0019835 [cytolysis] evidence: IEA GeneID:3002 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS GeneID:3002 -> Biological process: GO:1900740 [positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: TAS GeneID:3002 -> Cellular component: GO:0001772 [immunological synapse] evidence: TAS GeneID:3002 -> Cellular component: GO:0005634 [nucleus] evidence: TAS GeneID:3002 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA GeneID:3002 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:3002 -> Cellular component: GO:0043231 [intracellular membrane-bounded organelle] evidence: IDA ANNOTATIONS from NCBI Entrez Gene (20130726): NP_004122 -> EC 3.4.21.79
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.