2024-04-19 22:46:57, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004098 2908 bp mRNA linear PRI 29-JUN-2013 DEFINITION Homo sapiens empty spiracles homeobox 2 (EMX2), transcript variant 1, mRNA. ACCESSION NM_004098 VERSION NM_004098.3 GI:164607120 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2908) AUTHORS Li,X., Hawkins,G.A., Ampleford,E.J., Moore,W.C., Li,H., Hastie,A.T., Howard,T.D., Boushey,H.A., Busse,W.W., Calhoun,W.J., Castro,M., Erzurum,S.C., Israel,E., Lemanske,R.F. Jr., Szefler,S.J., Wasserman,S.I., Wenzel,S.E., Peters,S.P., Meyers,D.A. and Bleecker,E.R. TITLE Genome-wide association study identifies T1 pathway genes associated with lung function in asthmatic patients JOURNAL J. Allergy Clin. Immunol. (2013) In press PUBMED 23541324 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 2908) AUTHORS Wilk,J.B., Shrine,N.R., Loehr,L.R., Zhao,J.H., Manichaikul,A., Lopez,L.M., Smith,A.V., Heckbert,S.R., Smolonska,J., Tang,W., Loth,D.W., Curjuric,I., Hui,J., Cho,M.H., Latourelle,J.C., Henry,A.P., Aldrich,M., Bakke,P., Beaty,T.H., Bentley,A.R., Borecki,I.B., Brusselle,G.G., Burkart,K.M., Chen,T.H., Couper,D., Crapo,J.D., Davies,G., Dupuis,J., Franceschini,N., Gulsvik,A., Hancock,D.B., Harris,T.B., Hofman,A., Imboden,M., James,A.L., Khaw,K.T., Lahousse,L., Launer,L.J., Litonjua,A., Liu,Y., Lohman,K.K., Lomas,D.A., Lumley,T., Marciante,K.D., McArdle,W.L., Meibohm,B., Morrison,A.C., Musk,A.W., Myers,R.H., North,K.E., Postma,D.S., Psaty,B.M., Rich,S.S., Rivadeneira,F., Rochat,T., Rotter,J.I., Artigas,M.S., Starr,J.M., Uitterlinden,A.G., Wareham,N.J., Wijmenga,C., Zanen,P., Province,M.A., Silverman,E.K., Deary,I.J., Palmer,L.J., Cassano,P.A., Gudnason,V., Barr,R.G., Loos,R.J., Strachan,D.P., London,S.J., Boezen,H.M., Probst-Hensch,N., Gharib,S.A., Hall,I.P., O'Connor,G.T., Tobin,M.D. and Stricker,B.H. TITLE Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction JOURNAL Am. J. Respir. Crit. Care Med. 186 (7), 622-632 (2012) PUBMED 22837378 REFERENCE 3 (bases 1 to 2908) AUTHORS Sinner,M.F., Porthan,K., Noseworthy,P.A., Havulinna,A.S., Tikkanen,J.T., Muller-Nurasyid,M., Peloso,G., Ulivi,S., Beckmann,B.M., Brockhaus,A.C., Cooper,R.R., Gasparini,P., Hengstenberg,C., Hwang,S.J., Iorio,A., Junttila,M.J., Klopp,N., Kahonen,M., Laaksonen,M.A., Lehtimaki,T., Lichtner,P., Lyytikainen,L.P., Martens,E., Meisinger,C., Meitinger,T., Merchant,F.M., Nieminen,M.S., Peters,A., Pietila,A., Perz,S., Oikarinen,L., Raitakari,O., Reinhard,W., Silander,K., Thorand,B., Wichmann,H.E., Sinagra,G., Viikari,J., O'Donnell,C.J., Ellinor,P.T., Huikuri,H.V., Kaab,S., Newton-Cheh,C. and Salomaa,V. TITLE A meta-analysis of genome-wide association studies of the electrocardiographic early repolarization pattern JOURNAL Heart Rhythm 9 (10), 1627-1634 (2012) PUBMED 22683750 REFERENCE 4 (bases 1 to 2908) AUTHORS Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K., Gibbs,R.A. and Butte,N.F. TITLE Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population JOURNAL PLoS ONE 7 (12), E51954 (2012) PUBMED 23251661 REFERENCE 5 (bases 1 to 2908) AUTHORS Li,J., Mo,M., Chen,Z., Chen,Z., Sheng,Q., Mu,H., Zhang,F., Zhang,Y., Zhi,X.Y., Li,H., He,B. and Zhou,H.M. TITLE Adenoviral delivery of the EMX2 gene suppresses growth in human gastric cancer JOURNAL PLoS ONE 7 (9), E45970 (2012) PUBMED 23029345 REMARK GeneRIF: EMX2 expression led to inhibition of cell proliferation and Wnt signaling pathway both in vitro and in a gastric cancer xenograft model in vivo. REFERENCE 6 (bases 1 to 2908) AUTHORS Guerrini,R. and Carrozzo,R. TITLE Epileptogenic brain malformations: clinical presentation, malformative patterns and indications for genetic testing JOURNAL Seizure 11 (SUPPL A), 532-543 (2002) PUBMED 12185771 REMARK GeneRIF: EMX2 gene has been reported in schezencephaly (cleft brain) including epilepsy in some patients. Review article REFERENCE 7 (bases 1 to 2908) AUTHORS Noonan,F.C., Mutch,D.G., Ann Mallon,M. and Goodfellow,P.J. TITLE Characterization of the homeodomain gene EMX2: sequence conservation, expression analysis, and a search for mutations in endometrial cancers JOURNAL Genomics 76 (1-3), 37-44 (2001) PUBMED 11549315 REFERENCE 8 (bases 1 to 2908) AUTHORS Brunelli,S., Faiella,A., Capra,V., Nigro,V., Simeone,A., Cama,A. and Boncinelli,E. TITLE Germline mutations in the homeobox gene EMX2 in patients with severe schizencephaly JOURNAL Nat. Genet. 12 (1), 94-96 (1996) PUBMED 8528262 REFERENCE 9 (bases 1 to 2908) AUTHORS Kastury,K., Druck,T., Huebner,K., Barletta,C., Acampora,D., Simeone,A., Faiella,A. and Boncinelli,E. TITLE Chromosome locations of human EMX and OTX genes JOURNAL Genomics 22 (1), 41-45 (1994) PUBMED 7959790 REFERENCE 10 (bases 1 to 2908) AUTHORS Simeone,A., Gulisano,M., Acampora,D., Stornaiuolo,A., Rambaldi,M. and Boncinelli,E. TITLE Two vertebrate homeobox genes related to the Drosophila empty spiracles gene are expressed in the embryonic cerebral cortex JOURNAL EMBO J. 11 (7), 2541-2550 (1992) PUBMED 1352754 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AF301598.1 and AI701984.1. This sequence is a reference standard in the RefSeqGene project. On Jan 11, 2008 this sequence version replaced gi:31542586. Summary: This gene encodes a homeobox-containing transcription factor that is the homolog to the 'empty spiracles' gene in Drosophila. Research on this gene in humans has focused on its expression in three tissues: dorsal telencephalon, olfactory neuroepithelium, and urogenetial system. It is expressed in the dorsal telencephalon during development in a low rostral-lateral to high caudal-medial gradient and is proposed to pattern the neocortex into defined functional areas. It is also expressed in embryonic and adult olfactory neuroepithelia where it complexes with eukaryotic translation initiation factor 4E (eIF4E) and possibly regulates mRNA transport or translation. In the developing urogenital system, it is expressed in epithelial tissues and is negatively regulated by HOXA10. Alternative splicing results in multiple transcript variants encoding distinct proteins.[provided by RefSeq, Sep 2009]. Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF301598.1, AK055041.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2892 AF301598.1 1-2892 2893-2908 AI701984.1 1-16 c FEATURES Location/Qualifiers source 1..2908 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="10" /map="10q26.1" gene 1..2908 /gene="EMX2" /note="empty spiracles homeobox 2" /db_xref="GeneID:2018" /db_xref="HGNC:3341" /db_xref="HPRD:02495" /db_xref="MIM:600035" exon 1..1229 /gene="EMX2" /inference="alignment:Splign:1.39.8" variation 150 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:12777466" variation 187 /gene="EMX2" /replace="c" /replace="g" /db_xref="dbSNP:375090740" variation 268 /gene="EMX2" /replace="g" /replace="t" /db_xref="dbSNP:193287673" misc_feature 284..286 /gene="EMX2" /note="upstream in-frame stop codon" variation 386..387 /gene="EMX2" /replace="" /replace="t" /db_xref="dbSNP:368535750" variation 423 /gene="EMX2" /replace="c" /replace="g" /db_xref="dbSNP:375486605" variation 456 /gene="EMX2" /replace="c" /replace="t" /db_xref="dbSNP:12777755" variation 470 /gene="EMX2" /replace="" /replace="t" /db_xref="dbSNP:71013666" variation 488 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:60309535" variation 494 /gene="EMX2" /replace="" /replace="g" /db_xref="dbSNP:374002074" variation 645 /gene="EMX2" /replace="c" /replace="t" /db_xref="dbSNP:372863199" variation 659 /gene="EMX2" /replace="g" /replace="t" /db_xref="dbSNP:12784456" variation 688..693 /gene="EMX2" /replace="" /replace="ccccca" /db_xref="dbSNP:149284992" STS 728..2000 /gene="EMX2" /db_xref="UniSTS:481530" variation 737 /gene="EMX2" /replace="g" /replace="t" /db_xref="dbSNP:369213869" variation 778 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:8192643" STS 779..1618 /gene="EMX2" /db_xref="UniSTS:482320" CDS 824..1582 /gene="EMX2" /note="isoform 1 is encoded by transcript variant 1; empty spiracles-like protein 2; homeobox protein EMX2; empty spiracles homolog 2" /codon_start=1 /product="homeobox protein EMX2 isoform 1" /protein_id="NP_004089.1" /db_xref="GI:14149611" /db_xref="CCDS:CCDS7601.1" /db_xref="GeneID:2018" /db_xref="HGNC:3341" /db_xref="HPRD:02495" /db_xref="MIM:600035" /translation="
MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEGSDSQQKKKGTHHINRWRIATKQASPEEIDVTSDD
" misc_feature 1286..1462 /gene="EMX2" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(1286..1300,1304..1306,1355..1357,1373..1375, 1412..1414,1418..1423,1430..1435,1439..1447,1451..1456) /gene="EMX2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(1292..1294,1301..1303,1421..1423,1430..1435, 1442..1444) /gene="EMX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" variation 836 /gene="EMX2" /replace="c" /replace="g" /db_xref="dbSNP:371549541" variation 865 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:375691102" variation 893 /gene="EMX2" /replace="g" /replace="t" /db_xref="dbSNP:369744669" variation 916 /gene="EMX2" /replace="c" /replace="g" /db_xref="dbSNP:146160041" variation 928 /gene="EMX2" /replace="a" /replace="t" /db_xref="dbSNP:373030604" variation 944 /gene="EMX2" /replace="g" /replace="t" /db_xref="dbSNP:140164453" variation 961 /gene="EMX2" /replace="g" /replace="t" /db_xref="dbSNP:377504325" variation 1069 /gene="EMX2" /replace="c" /replace="g" /db_xref="dbSNP:371177025" variation 1079 /gene="EMX2" /replace="c" /replace="t" /db_xref="dbSNP:113852997" variation 1082 /gene="EMX2" /replace="c" /replace="t" /db_xref="dbSNP:200918900" variation 1095 /gene="EMX2" /replace="a" /replace="c" /db_xref="dbSNP:200357168" variation 1114 /gene="EMX2" /replace="a" /replace="c" /db_xref="dbSNP:149834474" variation 1144 /gene="EMX2" /replace="c" /replace="g" /db_xref="dbSNP:376153573" variation 1161 /gene="EMX2" /replace="a" /replace="t" /db_xref="dbSNP:370537063" variation 1171 /gene="EMX2" /replace="g" /replace="t" /db_xref="dbSNP:144775289" STS 1175..1564 /gene="EMX2" /standard_name="Emx2" /db_xref="UniSTS:530684" variation 1198 /gene="EMX2" /replace="c" /replace="t" /db_xref="dbSNP:148439570" exon 1230..1414 /gene="EMX2" /inference="alignment:Splign:1.39.8" variation 1289 /gene="EMX2" /replace="a" /replace="c" /db_xref="dbSNP:8192642" variation 1325 /gene="EMX2" /replace="a" /replace="c" /db_xref="dbSNP:147576243" variation 1358 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:371880298" variation 1367 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:141981608" variation 1369 /gene="EMX2" /replace="g" /replace="t" /db_xref="dbSNP:424112" exon 1415..2896 /gene="EMX2" /inference="alignment:Splign:1.39.8" variation 1476 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:200981903" variation 1545 /gene="EMX2" /replace="c" /replace="t" /db_xref="dbSNP:376235349" variation 1548 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:147858760" variation 1608 /gene="EMX2" /replace="c" /replace="t" /db_xref="dbSNP:146762820" variation 1616 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:56407327" variation 1618 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:376621996" variation 1619..1620 /gene="EMX2" /replace="" /replace="t" /db_xref="dbSNP:35212038" variation 1691 /gene="EMX2" /replace="c" /replace="g" /db_xref="dbSNP:139391042" variation 1700 /gene="EMX2" /replace="g" /replace="t" /db_xref="dbSNP:191919707" STS 1754..1957 /gene="EMX2" /standard_name="Emx2" /db_xref="UniSTS:142986" variation 1881 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:11814647" variation 1888 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:11814648" variation 1892 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:11818517" variation 1898 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:11814649" variation 1899..1902 /gene="EMX2" /replace="" /replace="agag" /db_xref="dbSNP:66710107" variation 1899..1900 /gene="EMX2" /replace="" /replace="ag" /db_xref="dbSNP:113566709" variation 1901..1904 /gene="EMX2" /replace="" /replace="agag" /db_xref="dbSNP:34929200" variation 1902..1905 /gene="EMX2" /replace="" /replace="gaga" /db_xref="dbSNP:146292406" variation 1902 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:11818518" variation 1914 /gene="EMX2" /replace="c" /replace="g" /db_xref="dbSNP:56380433" variation 1920..1923 /gene="EMX2" /replace="" /replace="gaga" /db_xref="dbSNP:55851441" variation 1928 /gene="EMX2" /replace="g" /replace="t" /db_xref="dbSNP:447520" variation 2143 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:374374688" variation 2173 /gene="EMX2" /replace="" /replace="a" /db_xref="dbSNP:72541118" variation 2207 /gene="EMX2" /replace="c" /replace="t" /db_xref="dbSNP:143671290" variation 2255 /gene="EMX2" /replace="g" /replace="t" /db_xref="dbSNP:75535495" variation 2385 /gene="EMX2" /replace="c" /replace="g" /db_xref="dbSNP:374436349" variation 2416 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:371551174" variation 2460 /gene="EMX2" /replace="a" /replace="g" /db_xref="dbSNP:182380025" variation 2498 /gene="EMX2" /replace="a" /replace="t" /db_xref="dbSNP:148079404" variation 2507 /gene="EMX2" /replace="c" /replace="t" /db_xref="dbSNP:187010704" variation 2581 /gene="EMX2" /replace="c" /replace="t" /db_xref="dbSNP:141898399" STS 2656..2862 /gene="EMX2" /standard_name="STS-AA025104" /db_xref="UniSTS:21044" variation 2783 /gene="EMX2" /replace="c" /replace="t" /db_xref="dbSNP:41284394" ORIGIN
cgggcgccgcaggagcgagtgagctgggagcgaggggcgaaggcgcggagaagcccggccgcccggtgggcggcagaaggctcagccgaggcggcggcgccgactccgttccactctcggcccggatccaggcctccgggttcccaggcgctcacctccctctgacgcactttaaagagtctccccccttccacctcagggcgagtaatagcgaccaatcatcaagccatttaccaggcttcggaggaagctgtttatgtgatccccgcactaattaggctcatgaactaacaaatcgtttgcacaacttgtgaagaagcgaacacttccatggattgtccttggacttagggcgccctgcccgccttttgcagaggagaaaaaacttttttttttttttgcctcccccgagaactttccccccttctcctccctgcctctaactccgatccccccacgccatctcgccaaaaaaaaaaaaaaaaaaaaaaaagaaaaaaaaagaaaaaaaaagaaaaaaaattaccccaatccacgcctgcaaattcttctggaaggattttcccccctctcttcaggttgggcgcgtttggtgcaagattctcgggatcctcggctttgcctctccctctccctcccccctcctttcctttttcctttcctttcctttctttcttcctttccttccccccacccccacccccaccccaaacaaacgagtccccaattctcgtccgtcctcgccgcgggcagcgggcggcggaggcagcgtgcggcggtcgccaggagctgggagcccagggcgcccgctcctcggcgcagcatgttccagccggcgcccaagcgctgcttcaccatcgagtcgctggtggccaaggacagtcccctgcccgcctcgcgctccgaggaccccatccgtcccgcggcactcagctacgctaactccagccccataaatccgttcctcaacggcttccactcggccgccgccgccgccgccggtaggggcgtctactccaacccggacttggtgttcgccgaggcggtctcgcacccgcccaaccccgccgtgccagtgcacccggtgccgccgccgcacgccctggccgcccaccccctaccctcctcgcactcgccacaccccctattcgcctcgcagcagcgggatccgtccaccttctacccctggctcatccaccgctaccgatatctgggtcatcgcttccaagggaacgacactagccccgagagtttccttttgcacaacgcgctggcccgaaagcccaagcggatccgaaccgccttctccccgtcccagcttctaaggctggaacacgcctttgagaagaatcactacgtggtgggcgccgaaaggaagcagctggcacacagcctcagcctcacggaaactcaggtaaaagtatggtttcagaaccgaagaacaaagttcaaaaggcagaagctggaggaagaaggctcagattcgcaacaaaagaaaaaagggacgcaccatattaaccggtggagaatcgccaccaagcaggcgagtccggaggaaatagacgtgacctcagatgattaaaaacataaacctaaccccacagaaacggacaacatggagcaaaagagacagggagaggtggagaaggaaaaaaccctacaaaacaaaaacaaaccgcatacacgttcaccgagaaagggagagggaatcggagggagcagcggaatgcggcgaagactctggacagcgagggcacagggtcccaaaccgaggccgcgccaagatggcagaggatggaggctccttcatcaacaagcgaccctcgtctaaagaggcagctgagtgagagacacagagagaaggagaaagagggagggagagagagaaagagagagaaagagagagagagagagagagagagaaagctgaacgtgcactctgacaaggggagctgtcaatcaaacaccaaaccggggagacaagatgattggcaggtattccgtttatcacagtccacttaaaaaatgatgatgatgataaaaaccacgacccaaccaggcacaggacttttttgttttttgcacttcgctgtgtttcccccccatctttaaaaataattagtaataaaaaacaaaaattccatatctagccccatcccacacctgtttcaaatccttgaaatgcatgtagcagttgttgggcgaatggtgtttaaagaccgaaaatgaattgtaattttcttttccttttaaagacaggttctgtgtgctttttattttgattttttttcccaagaaatgtgcagtctgtaaacactttttgataccttctgatgtcaaagtgattgtgcaagctaaatgaagtaggctcagcgatagtggtcctcttacagagaaacggggagcaggacgacgggggggctgggggtggcgggggagggtgcccacaaaaagaatcaggacttgtactgggaaaaaaacccctaaattaattatatttcttggacattccctttcctaacatcctgaggcttaaaaccctgatgcaaacttctcctttcagtggttggagaaattggccgagttcaaccattcactgcaatgcctattccaaactttaaatctatctattgcaaaacctgaaggactgtagttagcggggatgatgttaagtgtggccaagcgcacggcggcaagttttcaagcactgagtttctattccaagatcatagacttactaaagagagtgacaaatgcttccttaatgtcttctataccagaatgtaaatatttttgtgttttgtgttaatttgttagaattctaacacactatatacttccaagaagtatgtcaatgtcaatattttgtcaataaagatttatcaatatgccctcaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:2018 -> Molecular function: GO:0000976 [transcription regulatory region sequence-specific DNA binding] evidence: IEA GeneID:2018 -> Molecular function: GO:0003677 [DNA binding] evidence: NAS GeneID:2018 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA GeneID:2018 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:2018 -> Biological process: GO:0007275 [multicellular organismal development] evidence: NAS GeneID:2018 -> Biological process: GO:0009952 [anterior/posterior pattern specification] evidence: IEA GeneID:2018 -> Biological process: GO:0021542 [dentate gyrus development] evidence: IEA GeneID:2018 -> Biological process: GO:0021796 [cerebral cortex regionalization] evidence: IEA GeneID:2018 -> Biological process: GO:0021846 [cell proliferation in forebrain] evidence: IEA GeneID:2018 -> Biological process: GO:0021885 [forebrain cell migration] evidence: IEA GeneID:2018 -> Biological process: GO:0030182 [neuron differentiation] evidence: IEA GeneID:2018 -> Biological process: GO:0042493 [response to drug] evidence: IEA GeneID:2018 -> Biological process: GO:0072001 [renal system development] evidence: IEA GeneID:2018 -> Cellular component: GO:0005634 [nucleus] evidence: NAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.