Home |
Help |
Advanced search
2024-04-20 03:46:07, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004052 1535 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens BCL2/adenovirus E1B 19kDa interacting protein 3
(BNIP3), mRNA.
ACCESSION NM_004052
VERSION NM_004052.2 GI:7669480
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1535)
AUTHORS Lakshmi,S.V., Naushad,S.M., Reddy,C.A., Saumya,K., Rao,D.S.,
Kotamraju,S. and Kutala,V.K.
TITLE Oxidative stress in coronary artery disease: epigenetic perspective
JOURNAL Mol. Cell. Biochem. 374 (1-2), 203-211 (2013)
PUBMED 23160801
REMARK GeneRIF: results suggest aberrations in one-carbon metabolism
appear to induce altered gene expression of EC-SOD, GSTP1, and
BNIP3, and thus contribute to the increased oxidative stress and
increased susceptibility to coronary artery disease
REFERENCE 2 (bases 1 to 1535)
AUTHORS Zhu,Y., Massen,S., Terenzio,M., Lang,V., Chen-Lindner,S., Eils,R.,
Novak,I., Dikic,I., Hamacher-Brady,A. and Brady,N.R.
TITLE Modulation of serines 17 and 24 in the LC3-interacting region of
Bnip3 determines pro-survival mitophagy versus apoptosis
JOURNAL J. Biol. Chem. 288 (2), 1099-1113 (2013)
PUBMED 23209295
REMARK GeneRIF: pro-survival Bcl-x(L) positively regulated Bnip3 binding
to LC3B, sequestration, and mitochondrial autophagy, further
supporting an anti-apoptotic role for Bnip3-induced mitophagy
REFERENCE 3 (bases 1 to 1535)
AUTHORS Hanna,R.A., Quinsay,M.N., Orogo,A.M., Giang,K., Rikka,S. and
Gustafsson,A.B.
TITLE Microtubule-associated protein 1 light chain 3 (LC3) interacts with
Bnip3 protein to selectively remove endoplasmic reticulum and
mitochondria via autophagy
JOURNAL J. Biol. Chem. 287 (23), 19094-19104 (2012)
PUBMED 22505714
REMARK GeneRIF: Bnip3 induced removal of both ER (ERphagy) and
mitochondria (mitophagy) via autophagy. The clearance of these
organelles was mediated in part via binding of Bnip3 to LC3 on the
autophagosome.
REFERENCE 4 (bases 1 to 1535)
AUTHORS Cho,B., Choi,S.Y., Park,O.H., Sun,W. and Geum,D.
TITLE Differential expression of BNIP family members of BH3-only proteins
during the development and after axotomy in the rat
JOURNAL Mol. Cells 33 (6), 605-610 (2012)
PUBMED 22639046
REMARK GeneRIF: three members of the BNIP family, BNIP1, BNIP3 and BNIP3L,
are expressed in the developing brain with distinct brain region
specificity
REFERENCE 5 (bases 1 to 1535)
AUTHORS Jin,T., Lin,H.X., Lin,H., Guo,L.B., Ge,N., Cai,X.Y., Sun,R.,
Chen,W.K., Li,Q.L. and Hu,W.H.
TITLE Expression TGM2 and BNIP3 have prognostic significance in laryngeal
cancer patients receiving surgery and postoperative radiotherapy: a
retrospective study
JOURNAL J Transl Med 10, 64 (2012)
PUBMED 22458929
REMARK GeneRIF: BNIP3 expression and TGM2 expression are independent
prognostic factors in laryngeal SCC patients receiving
postoperative radiotherapy.
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 1535)
AUTHORS Chen,G., Cizeau,J., Vande Velde,C., Park,J.H., Bozek,G., Bolton,J.,
Shi,L., Dubik,D. and Greenberg,A.
TITLE Nix and Nip3 form a subfamily of pro-apoptotic mitochondrial
proteins
JOURNAL J. Biol. Chem. 274 (1), 7-10 (1999)
PUBMED 9867803
REFERENCE 7 (bases 1 to 1535)
AUTHORS Yasuda,M., Theodorakis,P., Subramanian,T. and Chinnadurai,G.
TITLE Adenovirus E1B-19K/BCL-2 interacting protein BNIP3 contains a BH3
domain and a mitochondrial targeting sequence
JOURNAL J. Biol. Chem. 273 (20), 12415-12421 (1998)
PUBMED 9575197
REFERENCE 8 (bases 1 to 1535)
AUTHORS Chen,G., Ray,R., Dubik,D., Shi,L., Cizeau,J., Bleackley,R.C.,
Saxena,S., Gietz,R.D. and Greenberg,A.H.
TITLE The E1B 19K/Bcl-2-binding protein Nip3 is a dimeric mitochondrial
protein that activates apoptosis
JOURNAL J. Exp. Med. 186 (12), 1975-1983 (1997)
PUBMED 9396766
REFERENCE 9 (bases 1 to 1535)
AUTHORS Kataoka,N., Ohno,M., Moda,I. and Shimura,Y.
TITLE Identification of the factors that interact with NCBP, an 80 kDa
nuclear cap binding protein
JOURNAL Nucleic Acids Res. 23 (18), 3638-3641 (1995)
PUBMED 7478990
REFERENCE 10 (bases 1 to 1535)
AUTHORS Boyd,J.M., Malstrom,S., Subramanian,T., Venkatesh,L.K.,
Schaeper,U., Elangovan,B., D'Sa-Eipper,C. and Chinnadurai,G.
TITLE Adenovirus E1B 19 kDa and Bcl-2 proteins interact with a common set
of cellular proteins
JOURNAL Cell 79 (2), 341-351 (1994)
PUBMED 7954800
REMARK Erratum:[Cell. 1994 Dec 16;79(6):1121. PMID: 8001138]
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AF002697.1.
On Apr 28, 2000 this sequence version replaced gi:4757857.
Summary: This gene is a member of the BCL2/adenovirus E1B 19
kd-interacting protein (BNIP) family. It interacts with the E1B 19
kDa protein, which protects cells from virally-induced cell death.
The encoded protein also interacts with E1B 19 kDa-like sequences
of BCL2, another apoptotic protector. This protein contains a BH3
domain and a transmembrane domain, which have been associated with
pro-apoptotic function. The dimeric mitochondrial protein encoded
by this gene is known to induce apoptosis, even in the presence of
BCL2. [provided by RefSeq, Mar 2011].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AF002697.1, BC067818.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025088 [ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
gene product(s) localized to mito. :: inferred from homology
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers
source 1..1535
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="10"
/map="10q26.3"
gene 1..1535
/gene="BNIP3"
/gene_synonym="NIP3"
/note="BCL2/adenovirus E1B 19kDa interacting protein 3"
/db_xref="GeneID:664"
/db_xref="HGNC:1084"
/db_xref="HPRD:04482"
/db_xref="MIM:603293"
variation 37
/gene="BNIP3"
/gene_synonym="NIP3"
/replace="c"
/replace="g"
/db_xref="dbSNP:45541140"
variation 46
/gene="BNIP3"
/gene_synonym="NIP3"
/replace="g"
/replace="t"
/db_xref="dbSNP:11556626"
variation 92
/gene="BNIP3"
/gene_synonym="NIP3"
/replace="a"
/replace="g"
/db_xref="dbSNP:11556627"
CDS 127..711
/gene="BNIP3"
/gene_synonym="NIP3"
/codon_start=1
/product="BCL2/adenovirus E1B 19 kDa protein-interacting
protein 3"
/protein_id="NP_004043.2"
/db_xref="GI:7669481"
/db_xref="CCDS:CCDS7663.1"
/db_xref="GeneID:664"
/db_xref="HGNC:1084"
/db_xref="HPRD:04482"
/db_xref="MIM:603293"
/translation="
MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF
"
misc_feature 127..702
/gene="BNIP3"
/gene_synonym="NIP3"
/note="Region: BNIP3; pfam06553"
/db_xref="CDD:148263"
misc_feature 382..384
/gene="BNIP3"
/gene_synonym="NIP3"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q12983.2); phosphorylation site"
misc_feature 424..501
/gene="BNIP3"
/gene_synonym="NIP3"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q12983.2);
Region: BH3"
misc_feature 616..678
/gene="BNIP3"
/gene_synonym="NIP3"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q12983.2);
transmembrane region"
STS 353..496
/gene="BNIP3"
/gene_synonym="NIP3"
/standard_name="RH70571"
/db_xref="UniSTS:29292"
variation 360
/gene="BNIP3"
/gene_synonym="NIP3"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1050704"
STS 564..712
/gene="BNIP3"
/gene_synonym="NIP3"
/standard_name="RH71202"
/db_xref="UniSTS:41823"
variation 672
/gene="BNIP3"
/gene_synonym="NIP3"
/replace="c"
/replace="t"
/db_xref="dbSNP:45471102"
STS 901..1036
/gene="BNIP3"
/gene_synonym="NIP3"
/standard_name="G54089"
/db_xref="UniSTS:109326"
variation 941
/gene="BNIP3"
/gene_synonym="NIP3"
/replace="a"
/replace="g"
/db_xref="dbSNP:4550"
variation 971
/gene="BNIP3"
/gene_synonym="NIP3"
/replace="c"
/replace="t"
/db_xref="dbSNP:45529444"
variation 1156
/gene="BNIP3"
/gene_synonym="NIP3"
/replace="a"
/replace="c"
/db_xref="dbSNP:1801945"
variation 1290
/gene="BNIP3"
/gene_synonym="NIP3"
/replace="a"
/replace="g"
/db_xref="dbSNP:6557"
STS 1297..1496
/gene="BNIP3"
/gene_synonym="NIP3"
/standard_name="RH80015"
/db_xref="UniSTS:88385"
variation 1303
/gene="BNIP3"
/gene_synonym="NIP3"
/replace="a"
/replace="t"
/db_xref="dbSNP:1801943"
variation 1417
/gene="BNIP3"
/gene_synonym="NIP3"
/replace="a"
/replace="g"
/db_xref="dbSNP:1801944"
polyA_signal 1526..1531
/gene="BNIP3"
/gene_synonym="NIP3"
ORIGIN
cctccgctcagtccgggagcgcacgtgggccgcggcgctccgacctccgctttcccaccgcccgcagctgaagcacatcccgcagcccggcgcggactccgatcgccgcagttgccctctggcgccatgtcgcagaacggagcgcccgggatgcaggaggagagcctgcagggctcctgggtagaactgcacttcagcaataatgggaacgggggcagcgttccagcctcggtttctatttataatggagacatggaaaaaatactgctggacgcacagcatgagtctggacggagtagctccaagagctctcactgtgacagcccacctcgctcgcagacaccacaagataccaacagggcttctgaaacagatacccatagcattggagagaaaaacagctcacagtctgaggaagatgatattgaaagaaggaaagaagttgaaagcatcttgaagaaaaactcagattggatatgggattggtcaagtcggccggaaaatattccccccaaggagttcctctttaaacacccgaagcgcacggccaccctcagcatgaggaacacgagcgtcatgaagaaagggggcatattctctgcagaatttctgaaagttttccttccatctctgctgctctctcatttgctggccatcggattggggatctatattggaaggcgtctgacaacctccaccagcaccttttgatgaagaactggagtctgacttggttcgttagtggattacttctgagcttgcaacatagctcactgaagagctgttagatcctggggtggccacgtcacttgtgtttatttgttctgtaaatgctgcgttcctaatttagtaaaataaaagaatagacactaaaatcatgttgatctataattacacctatgggatcaataagcatgtcagactgattaatgtctactgtgaaaatttggtagtaaattttcatttgatattagatataaatatctgaatataaataattttaatatactagtcatgatgtgtgttgtattttaaaaattatctgcaaccttaattcagctgaagtactttatatttcaaaagaatgaataacattgataataaaatcgctactttaaggggtttgtccaaaataaatattgtggccttatatatcacactattgtagaaagtattatttaatttaaatggatgcaggttgtctactaaagaaagattatatataactatgctaattgttcataatcaacagaaaccaagatagagctacaaactcagctgtacagttcgtacactaaactcttcttgcttttgcattataaggaattaagtctccgattattaggtgatcaccctggatgatcagttttctgctgaaggcacctactcagtatcttttcctctttatcactctgcattggtgaatttaatcctctcctttgtgttcaacttttgtgtgcttttaaaatcagctttattctaagcaaatctgtgtctactttaaaaaactggaaatggaaaaaaaaataaatctt
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:664 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:664 -> Molecular function: GO:0042802 [identical protein binding] evidence: IPI
GeneID:664 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IDA
GeneID:664 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IDA
GeneID:664 -> Molecular function: GO:0051020 [GTPase binding] evidence: IPI
GeneID:664 -> Biological process: GO:0001666 [response to hypoxia] evidence: ISS
GeneID:664 -> Biological process: GO:0006309 [apoptotic DNA fragmentation] evidence: IDA
GeneID:664 -> Biological process: GO:0006338 [chromatin remodeling] evidence: IDA
GeneID:664 -> Biological process: GO:0006915 [apoptotic process] evidence: IPI
GeneID:664 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IDA
GeneID:664 -> Biological process: GO:0008219 [cell death] evidence: IDA
GeneID:664 -> Biological process: GO:0008219 [cell death] evidence: ISS
GeneID:664 -> Biological process: GO:0008626 [granzyme-mediated apoptotic signaling pathway] evidence: IDA
GeneID:664 -> Biological process: GO:0010637 [negative regulation of mitochondrial fusion] evidence: IDA
GeneID:664 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
GeneID:664 -> Biological process: GO:0035694 [mitochondrial protein catabolic process] evidence: IMP
GeneID:664 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:664 -> Biological process: GO:0043243 [positive regulation of protein complex disassembly] evidence: IDA
GeneID:664 -> Biological process: GO:0043653 [mitochondrial fragmentation involved in apoptotic process] evidence: IDA
GeneID:664 -> Biological process: GO:0045837 [negative regulation of membrane potential] evidence: IDA
GeneID:664 -> Biological process: GO:0046902 [regulation of mitochondrial membrane permeability] evidence: IDA
GeneID:664 -> Biological process: GO:0048102 [autophagic cell death] evidence: IEA
GeneID:664 -> Biological process: GO:0050873 [brown fat cell differentiation] evidence: IEA
GeneID:664 -> Biological process: GO:0051402 [neuron apoptotic process] evidence: ISS
GeneID:664 -> Biological process: GO:0051607 [defense response to virus] evidence: IDA
GeneID:664 -> Biological process: GO:0055093 [response to hyperoxia] evidence: IEA
GeneID:664 -> Biological process: GO:0070301 [cellular response to hydrogen peroxide] evidence: IEA
GeneID:664 -> Biological process: GO:0071260 [cellular response to mechanical stimulus] evidence: IEP
GeneID:664 -> Biological process: GO:0071279 [cellular response to cobalt ion] evidence: IMP
GeneID:664 -> Biological process: GO:0071456 [cellular response to hypoxia] evidence: IMP
GeneID:664 -> Biological process: GO:0072593 [reactive oxygen species metabolic process] evidence: IDA
GeneID:664 -> Biological process: GO:0090141 [positive regulation of mitochondrial fission] evidence: IDA
GeneID:664 -> Biological process: GO:0090200 [positive regulation of release of cytochrome c from mitochondria] evidence: IDA
GeneID:664 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: IEA
GeneID:664 -> Biological process: GO:0097345 [mitochondrial outer membrane permeabilization] evidence: IDA
GeneID:664 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:664 -> Cellular component: GO:0005634 [nucleus] evidence: ISS
GeneID:664 -> Cellular component: GO:0005635 [nuclear envelope] evidence: IDA
GeneID:664 -> Cellular component: GO:0005654 [nucleoplasm] evidence: ISS
GeneID:664 -> Cellular component: GO:0005737 [cytoplasm] evidence: ISS
GeneID:664 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA
GeneID:664 -> Cellular component: GO:0005739 [mitochondrion] evidence: TAS
GeneID:664 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: IDA
GeneID:664 -> Cellular component: GO:0030425 [dendrite] evidence: ISS
GeneID:664 -> Cellular component: GO:0031307 [integral to mitochondrial outer membrane] evidence: IDA
GeneID:664 -> Cellular component: GO:0031966 [mitochondrial membrane] evidence: IDA
GeneID:664 -> Cellular component: GO:0031966 [mitochondrial membrane] evidence: IMP
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.