Home |
Help |
Advanced search
2024-04-20 08:23:55, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004050 3621 bp mRNA linear PRI 24-JUN-2013
DEFINITION Homo sapiens BCL2-like 2 (BCL2L2), transcript variant 1, mRNA.
ACCESSION NM_004050
VERSION NM_004050.4 GI:315360669
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3621)
AUTHORS Casanelles,E., Gozzelino,R., Marques-Fernandez,F.,
Iglesias-Guimarais,V., Garcia-Belinchon,M., Sanchez-Osuna,M.,
Sole,C., Moubarak,R.S., Comella,J.X. and Yuste,V.J.
TITLE NF-kappaB activation fails to protect cells to TNFalpha-induced
apoptosis in the absence of Bcl-xL, but not Mcl-1, Bcl-2 or Bcl-w
JOURNAL Biochim. Biophys. Acta 1833 (5), 1085-1095 (2013)
PUBMED 23369735
REMARK GeneRIF: we describe that the specific knockdown of Bcl-xL, but not
that of Bcl-2, Bcl-w or Mcl-1, renders cells sensitive to
TNFalpha-induced apoptosis.
REFERENCE 2 (bases 1 to 3621)
AUTHORS Wang,F., Liu,M., Li,X. and Tang,H.
TITLE MiR-214 reduces cell survival and enhances cisplatin-induced
cytotoxicity via down-regulation of Bcl2l2 in cervical cancer cells
JOURNAL FEBS Lett. 587 (5), 488-495 (2013)
PUBMED 23337879
REMARK GeneRIF: Expression of miR-214 reduces cell survival, induces
apoptosis and enhances sensitivity to cisplatin through directly
inhibiting Bcl2l2 expression.
REFERENCE 3 (bases 1 to 3621)
AUTHORS Guan,Z., Shi,N., Song,Y., Zhang,X., Zhang,M. and Duan,M.
TITLE Induction of the cellular microRNA-29c by influenza virus
contributes to virus-mediated apoptosis through repression of
antiapoptotic factors BCL2L2
JOURNAL Biochem. Biophys. Res. Commun. 425 (3), 662-667 (2012)
PUBMED 22850539
REMARK GeneRIF: These findings indicate that miR-29c-mediated BCL2L2
suppression is involved in influenza virus-induced cell death in
A549 cells.
REFERENCE 4 (bases 1 to 3621)
AUTHORS Kim,E.M., Kim,J., Park,J.K., Hwang,S.G., Kim,W.J., Lee,W.J.,
Kang,S.W. and Um,H.D.
TITLE Bcl-w promotes cell invasion by blocking the invasion-suppressing
action of Bax
JOURNAL Cell. Signal. 24 (6), 1163-1172 (2012)
PUBMED 22570867
REMARK GeneRIF: By using human cancer cells and mouse embryonic
fibroblasts, the study shows that BCL-W functions in the
mitochondria to increase the levels of reactive oxygen species
(ROS), which subsequently stimulates the invasion-promoting
signaling pathway.
REFERENCE 5 (bases 1 to 3621)
AUTHORS Guo,W.J., Jin,Z. and Wang,A.Y.
TITLE [Expression of Bcl-w protein in human small intestinal
adenocarcinoma and effect of Bcl-w siRNA on apoptosis in intestinal
adenocarcinoma HuTu-80 cells]
JOURNAL Zhonghua Zhong Liu Za Zhi 34 (3), 182-186 (2012)
PUBMED 22780970
REMARK GeneRIF: Bcl-w protein plays a significant role in the
carcinogenesis of human small intestinal adenocarcinoma.
Down-regulation of Bcl-w protein in HuTu-80 cells makes them
susceptible to 5-Fu.
REFERENCE 6 (bases 1 to 3621)
AUTHORS Middleton,G., Wyatt,S., Ninkina,N. and Davies,A.M.
TITLE Reciprocal developmental changes in the roles of Bcl-w and Bcl-x(L)
in regulating sensory neuron survival
JOURNAL Development 128 (3), 447-457 (2001)
PUBMED 11152643
REFERENCE 7 (bases 1 to 3621)
AUTHORS Hsu,S.Y., Lin,P. and Hsueh,A.J.
TITLE BOD (Bcl-2-related ovarian death gene) is an ovarian BH3
domain-containing proapoptotic Bcl-2 protein capable of
dimerization with diverse antiapoptotic Bcl-2 members
JOURNAL Mol. Endocrinol. 12 (9), 1432-1440 (1998)
PUBMED 9731710
REFERENCE 8 (bases 1 to 3621)
AUTHORS Ross,A.J., Waymire,K.G., Moss,J.E., Parlow,A.F., Skinner,M.K.,
Russell,L.D. and MacGregor,G.R.
TITLE Testicular degeneration in Bclw-deficient mice
JOURNAL Nat. Genet. 18 (3), 251-256 (1998)
PUBMED 9500547
REFERENCE 9 (bases 1 to 3621)
AUTHORS O'Connor,L., Strasser,A., O'Reilly,L.A., Hausmann,G., Adams,J.M.,
Cory,S. and Huang,D.C.
TITLE Bim: a novel member of the Bcl-2 family that promotes apoptosis
JOURNAL EMBO J. 17 (2), 384-395 (1998)
PUBMED 9430630
REFERENCE 10 (bases 1 to 3621)
AUTHORS Gibson,L., Holmgreen,S.P., Huang,D.C., Bernard,O., Copeland,N.G.,
Jenkins,N.A., Sutherland,G.R., Baker,E., Adams,J.M. and Cory,S.
TITLE bcl-w, a novel member of the bcl-2 family, promotes cell survival
JOURNAL Oncogene 13 (4), 665-675 (1996)
PUBMED 8761287
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BP216712.1, BC104789.1,
BQ359913.1, AL049829.4 and BQ001111.1.
On Dec 22, 2010 this sequence version replaced gi:157266332.
Summary: This gene encodes a member of the BCL-2 protein family.
The proteins of this family form hetero- or homodimers and act as
anti- and pro-apoptotic regulators. Expression of this gene in
cells has been shown to contribute to reduced cell apoptosis under
cytotoxic conditions. Studies of the related gene in mice indicated
a role in the survival of NGF- and BDNF-dependent neurons. Mutation
and knockout studies of the mouse gene demonstrated an essential
role in adult spermatogenesis. Alternative splicing results in
multiple transcript variants. Read-through transcription also
exists between this gene and the neighboring downstream PABPN1
(poly(A) binding protein, nuclear 1) gene. [provided by RefSeq, Dec
2010].
Transcript Variant: This variant (1) represents the longer
transcript. Both variants 1 and 2 encode the same protein.
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: D87461.1, BC104789.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-65 BP216712.1 1-65
66-1334 BC104789.1 2-1270
1335-1423 BQ359913.1 185-273
1424-3081 AL049829.4 91636-93293
3082-3621 BQ001111.1 1-540 c
FEATURES Location/Qualifiers
source 1..3621
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="14"
/map="14q11.2-q12"
gene 1..3621
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/note="BCL2-like 2"
/db_xref="GeneID:599"
/db_xref="HGNC:995"
/db_xref="HPRD:03569"
/db_xref="MIM:601931"
exon 1..133
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/inference="alignment:Splign:1.39.8"
variation 33
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:368378909"
variation 34
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:189492896"
STS 65..1643
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/db_xref="UniSTS:488076"
exon 134..221
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/inference="alignment:Splign:1.39.8"
variation 175
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:377264616"
misc_feature 200..202
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/note="upstream in-frame stop codon"
exon 222..661
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/inference="alignment:Splign:1.39.8"
variation 223
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:181554850"
variation 224
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:375706345"
CDS 230..811
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/note="apoptosis regulator BCL-W; protein phosphatase 1,
regulatory subunit 51"
/codon_start=1
/product="bcl-2-like protein 2"
/protein_id="NP_004041.1"
/db_xref="GI:4757842"
/db_xref="CCDS:CCDS9591.1"
/db_xref="GeneID:599"
/db_xref="HGNC:995"
/db_xref="HPRD:03569"
/db_xref="MIM:601931"
/translation="
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
"
misc_feature 254..670
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/note="Apoptosis regulator proteins of the Bcl-2 family,
named after B-cell lymphoma 2. This alignment model spans
what have been described as Bcl-2 homology regions BH1,
BH2, BH3, and BH4. Many members of this family have an
additional C-terminal transmembrane...; Region:
Bcl-2_like; cd06845"
/db_xref="CDD:132900"
misc_feature 254..316
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q92843.2);
Region: BH4"
misc_feature 254..292
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/note="BH4; other site"
/db_xref="CDD:132900"
misc_feature <353..709
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/note="apoptosis regulator; Region: bcl-2; TIGR00865"
/db_xref="CDD:233158"
misc_feature 365..391
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/note="BH3; other site"
/db_xref="CDD:132900"
misc_feature order(374..379,383..388,398..400,407..412,458..463,
470..475,482..487,503..505,509..514,518..523,533..535,
545..547)
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/note="BH3-homology region binding site; other site"
/db_xref="CDD:132900"
misc_feature 482..541
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q92843.2);
Region: BH1"
misc_feature order(482..490,500..538)
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/note="BH1; other site"
/db_xref="CDD:132900"
misc_feature 635..682
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q92843.2);
Region: BH2"
misc_feature 635..670
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/note="BH2; other site"
/db_xref="CDD:132900"
variation 250
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:145819636"
variation 334
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:2231300"
variation 337
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:140247035"
variation 351
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="g"
/db_xref="dbSNP:372286720"
variation 352
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:2231301"
variation 357
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:137944195"
variation 370
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:374687458"
variation 404
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:377103042"
variation 405
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:372109088"
variation 424
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:369139282"
variation 457
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:1049463"
variation 461
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:143454020"
variation 478
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="c"
/db_xref="dbSNP:373000086"
variation 481
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:1049465"
variation 495
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:144907357"
variation 526
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:376965445"
variation 571
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:34019986"
variation 625
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:148533206"
variation 627..630
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace=""
/replace="agct"
/db_xref="dbSNP:200485369"
variation 627
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:910332"
variation 651
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:201407690"
exon 662..3605
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/inference="alignment:Splign:1.39.8"
variation 682
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:368889929"
variation 683
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:189909787"
variation 688
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:373089207"
variation 711
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:200041771"
variation 761
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:41317322"
variation 784
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:371070231"
variation 826
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:374244495"
variation 835
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:2231302"
variation 861
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="g"
/db_xref="dbSNP:200109175"
variation 871
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:180861464"
variation 1032
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:114093099"
variation 1045
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="g"
/replace="t"
/db_xref="dbSNP:28727519"
variation 1055
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace=""
/replace="g"
/db_xref="dbSNP:11286673"
variation 1079
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:186099381"
variation 1219
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:190956287"
variation 1301
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="g"
/replace="t"
/db_xref="dbSNP:59528193"
variation 1335
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:1950252"
variation 1358
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="t"
/db_xref="dbSNP:111480091"
variation 1428
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:368751711"
variation 1445
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:369662743"
variation 1448
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="g"
/db_xref="dbSNP:117138993"
variation 1577
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:59634591"
variation 1602
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:147292152"
variation 1742
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="g"
/replace="t"
/db_xref="dbSNP:141040681"
variation 1784
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:149848377"
variation 2086
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:183322615"
variation 2123
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="g"
/replace="t"
/db_xref="dbSNP:2076680"
variation 2139
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="t"
/db_xref="dbSNP:144693557"
variation 2271
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="g"
/db_xref="dbSNP:1535094"
variation 2304
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="t"
/db_xref="dbSNP:188775826"
variation 2342
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:79730308"
variation 2509
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:191138928"
variation 2514
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="c"
/db_xref="dbSNP:3210043"
variation 2577
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="g"
/replace="t"
/db_xref="dbSNP:78478800"
variation 2610
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:112933062"
variation 2668
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:183445900"
STS 2710..3606
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/standard_name="BCL2L2_718"
/db_xref="UniSTS:277027"
variation 2769
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:187184653"
variation 2784
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="g"
/db_xref="dbSNP:112390836"
variation 2859
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:10149339"
variation 2974..2975
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace=""
/replace="gg"
/db_xref="dbSNP:142850799"
variation 2976
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="g"
/replace="t"
/db_xref="dbSNP:374168548"
variation 3208
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace=""
/replace="ta"
/db_xref="dbSNP:56889032"
variation 3302
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:45519738"
variation 3345
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="a"
/replace="g"
/db_xref="dbSNP:191254635"
STS 3368..3596
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/standard_name="RH75103"
/db_xref="UniSTS:91127"
variation 3380
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:1049485"
variation 3416
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:183840707"
variation 3423
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/replace="c"
/replace="t"
/db_xref="dbSNP:142892590"
STS 3424..3594
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
/standard_name="EST16D6"
/db_xref="UniSTS:263142"
polyA_signal 3559..3564
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
polyA_signal 3568..3573
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
polyA_signal 3572..3577
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
polyA_site 3591
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
polyA_site 3594
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
polyA_site 3597
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
polyA_site 3605
/gene="BCL2L2"
/gene_synonym="BCL-W; BCL2-L-2; BCLW; PPP1R51"
ORIGIN
atcacccggcgccgggccctccctctgcccccccctttctcctccctccttccttccctcccttcctccctctctccctccctcccagctcctgcaccaggaaacggcccggatcccggcagcggcctgacccggctccacgctggccaggaggatgaaaggccccagctgggggctccttgccaccagtgctgtgtcttaagagctgccatcccggctggccgcccggatggcgaccccagcctcggccccagacacacgggctctggtggcagactttgtaggttataagctgaggcagaagggttatgtctgtggagctggccccggggagggcccagcagctgacccgctgcaccaagccatgcgggcagctggagatgagttcgagacccgcttccggcgcaccttctctgatctggcggctcagctgcatgtgaccccaggctcagcccaacaacgcttcacccaggtctccgatgaactttttcaagggggccccaactggggccgccttgtagccttctttgtctttggggctgcactgtgtgctgagagtgtcaacaaggagatggaaccactggtgggacaagtgcaggagtggatggtggcctacctggagacgcggctggctgactggatccacagcagtgggggctgggcggagttcacagctctatacggggacggggccctggaggaggcgcggcgtctgcgggaggggaactgggcatcagtgaggacagtgctgacgggggccgtggcactgggggccctggtaactgtaggggccttttttgctagcaagtgaaagtccagggccaggtggggctaggtgtggctgggggccaggagagcaggaacagaacagagaaatgcccttggaagaagtggagttggtggatgggtgggcatggaacaggatgggcagagaaagggtagtgtgtgagggagctgagtaggccaggtaggcgattggaagagtgagcaggacacagaggggaggggaatgttttggcaagtttaggggcacaggagatgtagtcgttccagggctgggggaggtgggagggatcacgcctataggtgtgggcacatgaaacgacctggaacttgcttcacagccctgaggaaggtggacttacataagcagctgtattccattagatgagtgggatttagggaacgcagaaggcacatccctttggaatggaagcttaggggttctcaggtgatagggagaggtggctgttaacagtgggctgcttggacacgcgtgtgcatgtgcacgcatgctggtgtgcatgctgggctgcctggcaaatctggtggtgatgggattcctcaaggagaaaacattccctcttgcaatggcaagaactaggggcagttctctgtccctcctcccaacccctcctttcccctgcccttgtcctgatgcctcaaggcttagagagaaacattgtatccagaccgagggctctgctgcttctttccagaaagtgattggcaaggctttggagagaagagcagttctgcagctggccttgttccttcatcatcccccttccttgtgcattatgcacttgctgctgcctcctgggctctgatagaagggcagggctgttgagcctggatgggtggaggcttaggtagccggacctgcctgccaccctcctctcccactcaggcacaatggtgcctaaagtgtttccaatctctgggacctctgtacccaaactgaaactctaaattggggccctaactaattttccttttgaggttgtgggcataagtgctgatctagaatacagtctgggtcccacactgtgtctcagtgagactgttgatgccttgagatgaccatttcagatctgaatcccatgggtgtgagggtgatgggtactccaggactggcctatgctgtgttgtgggctttggttcggctttatcaggggccaggcatatgggttctagagtacctaccatgacctagaagcatttatgatttatttgaagccacactgtttgcatgggtgttacttgtctgtacctcagagtctgaggatgttaactttggaactcgcagtcctctagaacagcttcagattatggctttttcttttgaggaagaaattattcactccagatgcatgccctgagccagacctcactgctgcactttccaaggtgctaagattgctgctctccaatgctaactttctgacacagtgctctagaaccctgcctgtggtcctgagcactgatcaccttagctagaccatggttgactcttcttggagattttcacttggtcctagaatgtggcaacgtagttgtgctcgccagaacgtgggaccaaattggcctcaggtgttgagtccagacttctgcttttgagagagggctgcactttttcatggtatttctaggggaggtggtaggctgcatgtgccacttggtcttgttgtgagtatgctgacaccagaaactcagagccagcttgtggcaagcagttggggtggggggtctctgacttgctcaggacaaactaggccagtggttttcaaactgcttggcagagccctgaagtttcctaggggttgcctcaggagtccttggggagatgaagggggtggggagctgagcaggctgggcaatttgccctcaaacagaacagctccccttgtagctgtcttacatattggggttcagggtaagattttatttgcattaaggggtttgctgctgaaaaaaagttggaaaaccactgactagaccatcggctccaaattggagtctgtgcttccttccccaggtatggagcacactcttcaccctaccctctaccacaggacacatatccctgttagcattccccgggacctttagccaagaggagctgcagggaccatggccaggttaccaaaatgccctgctctgaagccttgacacctgggtggaaagagaggctgttttctgaaagggtaaagggcttggtctggattcccagaagcatagcttagatgggaccacagtgggcaattttgacctgtcctgcccttcttagcttgaagggaaaccccagagactcttctgtcagggaaaactagggactctcttctagagccatatagttccttgggattagctcttggccaagaaggctgagtatggttcccaatttttaaatccatttcattttttaaaaaataagggaaataaatgtaattgccatttttcaaagattaagtaggaggagaggggtttcttgctctccagagcccaaagggacaaatagggactttgtttaggccaaggaaggagcggaagtagggcaactcggtcctgcgattattaatcccactccccacttattctagggcacacaaacactattttacttttttaaaatcataaaacggcagaacagatttggttagtttagaagaaaagaaagctctataaatataaatctatattcctgtatttttatttaataatttataaataccaagttcatttgacttttatttttgtgtaatatgtaatgatcgtattaaaaacaataaataaagcccagaagtttaatgagaaggactgaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:599 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:599 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:599 -> Biological process: GO:0007283 [spermatogenesis] evidence: TAS
GeneID:599 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IMP
GeneID:599 -> Biological process: GO:0060011 [Sertoli cell proliferation] evidence: IEA
GeneID:599 -> Cellular component: GO:0005829 [cytosol] evidence: IEA
GeneID:599 -> Cellular component: GO:0031966 [mitochondrial membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.