2024-05-02 06:47:18, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004049 899 bp mRNA linear PRI 26-MAY-2013 DEFINITION Homo sapiens BCL2-related protein A1 (BCL2A1), transcript variant 1, mRNA. ACCESSION NM_004049 VERSION NM_004049.3 GI:168480070 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 899) AUTHORS Haq,R., Yokoyama,S., Hawryluk,E.B., Jonsson,G.B., Frederick,D.T., McHenry,K., Porter,D., Tran,T.N., Love,K.T., Langer,R., Anderson,D.G., Garraway,L.A., Duncan,L.M., Morton,D.L., Hoon,D.S., Wargo,J.A., Song,J.S. and Fisher,D.E. TITLE BCL2A1 is a lineage-specific antiapoptotic melanoma oncogene that confers resistance to BRAF inhibition JOURNAL Proc. Natl. Acad. Sci. U.S.A. 110 (11), 4321-4326 (2013) PUBMED 23447565 REMARK GeneRIF: MITF-BCL2A1 as a lineage-specific oncogenic pathway in melanoma and underscore its role for improved response to BRAF-directed therapy. REFERENCE 2 (bases 1 to 899) AUTHORS Oh,J., Kim,S.H., Ahn,S. and Lee,C.E. TITLE Suppressors of cytokine signaling promote Fas-induced apoptosis through downregulation of NF-kappaB and mitochondrial Bfl-1 in leukemic T cells JOURNAL J. Immunol. 189 (12), 5561-5571 (2012) PUBMED 23152563 REMARK GeneRIF: Mitochondrial antiapoptotic factor Bfl-1 is significantly reduced by suppressor of cytokine signaling (SOCS)1. REFERENCE 3 (bases 1 to 899) AUTHORS Cruz-Munoz,W., Jaramillo,M.L., Man,S., Xu,P., Banville,M., Collins,C., Nantel,A., Francia,G., Morgan,S.S., Cranmer,L.D., O'Connor-McCourt,M.D. and Kerbel,R.S. TITLE Roles for endothelin receptor B and BCL2A1 in spontaneous CNS metastasis of melanoma JOURNAL Cancer Res. 72 (19), 4909-4919 (2012) PUBMED 22865454 REMARK GeneRIF: Data indicate that BCL2a1 expression enhances tumor cell survival in nervous system (CNS) leading to intracranial tumor growth. REFERENCE 4 (bases 1 to 899) AUTHORS Metais,J.Y., Winkler,T., Geyer,J.T., Calado,R.T., Aplan,P.D., Eckhaus,M.A. and Dunbar,C.E. TITLE BCL2A1a over-expression in murine hematopoietic stem and progenitor cells decreases apoptosis and results in hematopoietic transformation JOURNAL PLoS ONE 7 (10), E48267 (2012) PUBMED 23118966 REMARK GeneRIF: Bcl2a1 should be considered as a proto-oncogene with a potential role in both lymphoid and myeloid leukemogenesis REFERENCE 5 (bases 1 to 899) AUTHORS Valero,J.G., Cornut-Thibaut,A., Juge,R., Debaud,A.L., Gimenez,D., Gillet,G., Bonnefoy-Berard,N., Salgado,J., Salles,G., Aouacheria,A. and Kucharczak,J. TITLE micro-Calpain conversion of antiapoptotic Bfl-1 (BCL2A1) into a prodeath factor reveals two distinct alpha-helices inducing mitochondria-mediated apoptosis JOURNAL PLoS ONE 7 (6), E38620 (2012) PUBMED 22745672 REMARK GeneRIF: Data demonstrate that calpain-mediated cleavage of full-length Bfl-1 induces the release of C-terminal membrane active alpha-helices that are responsible for its conversion into a pro-apoptotic factor. REFERENCE 6 (bases 1 to 899) AUTHORS Karsan,A., Yee,E. and Harlan,J.M. TITLE Endothelial cell death induced by tumor necrosis factor-alpha is inhibited by the Bcl-2 family member, A1 JOURNAL J. Biol. Chem. 271 (44), 27201-27204 (1996) PUBMED 8910286 REFERENCE 7 (bases 1 to 899) AUTHORS Karsan,A., Yee,E., Kaushansky,K. and Harlan,J.M. TITLE Cloning of human Bcl-2 homologue: inflammatory cytokines induce human A1 in cultured endothelial cells JOURNAL Blood 87 (8), 3089-3096 (1996) PUBMED 8605321 REFERENCE 8 (bases 1 to 899) AUTHORS Choi,S.S., Park,I.C., Yun,J.W., Sung,Y.C., Hong,S.I. and Shin,H.S. TITLE A novel Bcl-2 related gene, Bfl-1, is overexpressed in stomach cancer and preferentially expressed in bone marrow JOURNAL Oncogene 11 (9), 1693-1698 (1995) PUBMED 7478596 REFERENCE 9 (bases 1 to 899) AUTHORS Savitsky,K., Sfez,S., Tagle,D.A., Ziv,Y., Sartiel,A., Collins,F.S., Shiloh,Y. and Rotman,G. TITLE The complete sequence of the coding region of the ATM gene reveals similarity to cell cycle regulators in different species JOURNAL Hum. Mol. Genet. 4 (11), 2025-2032 (1995) PUBMED 8589678 REFERENCE 10 (bases 1 to 899) AUTHORS Lin,E.Y., Orlofsky,A., Berger,M.S. and Prystowsky,M.B. TITLE Characterization of A1, a novel hemopoietic-specific early-response gene with sequence similarity to bcl-2 JOURNAL J. Immunol. 151 (4), 1979-1988 (1993) PUBMED 8345191 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BG198875.1, U27467.1 and BG204033.1. On Feb 22, 2008 this sequence version replaced gi:14574570. Summary: This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. The protein encoded by this gene is able to reduce the release of pro-apoptotic cytochrome c from mitochondria and block caspase activation. This gene is a direct transcription target of NF-kappa B in response to inflammatory mediators, and is up-regulated by different extracellular signals, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), CD40, phorbol ester and inflammatory cytokine TNF and IL-1, which suggests a cytoprotective function that is essential for lymphocyte activation as well as cell survival. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (1) encodes the longer isoform (1). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BG216703.1, Y09397.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-148 BG198875.1 147-294 149-885 U27467.1 1-737 886-899 BG204033.1 287-300 FEATURES Location/Qualifiers source 1..899 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="15" /map="15q24.3" gene 1..899 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /note="BCL2-related protein A1" /db_xref="GeneID:597" /db_xref="HGNC:991" /db_xref="HPRD:03034" /db_xref="MIM:601056" exon 1..602 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /inference="alignment:Splign:1.39.8" misc_feature 108..110 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /note="upstream in-frame stop codon" CDS 183..710 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /note="isoform 1 is encoded by transcript variant 1; hematopoietic BCL2-related protein A1; bcl2-L-5; protein BFL-1; bcl-2-like protein 5; hemopoietic-specific early response protein" /codon_start=1 /product="bcl-2-related protein A1 isoform 1" /protein_id="NP_004040.1" /db_xref="GI:4757840" /db_xref="CCDS:CCDS10312.1" /db_xref="GeneID:597" /db_xref="HGNC:991" /db_xref="HPRD:03034" /db_xref="MIM:601056" /translation="
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
" misc_feature 210..620 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /note="Apoptosis regulator proteins of the Bcl-2 family, named after B-cell lymphoma 2. This alignment model spans what have been described as Bcl-2 homology regions BH1, BH2, BH3, and BH4. Many members of this family have an additional C-terminal transmembrane...; Region: Bcl-2_like; cd06845" /db_xref="CDD:132900" misc_feature 210..242 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /note="BH4; other site" /db_xref="CDD:132900" misc_feature 291..317 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /note="BH3; other site" /db_xref="CDD:132900" misc_feature order(300..305,309..314,324..326,333..338,387..392, 399..404,411..416,435..437,441..446,450..455,465..467, 477..479) /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /note="BH3-homology region binding site; other site" /db_xref="CDD:132900" misc_feature 411..473 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q16548.1); Region: BH1" misc_feature order(411..419,432..470) /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /note="BH1; other site" /db_xref="CDD:132900" misc_feature 576..623 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q16548.1); Region: BH2" misc_feature order(576..605,609..620) /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /note="BH2; other site" /db_xref="CDD:132900" STS 210..524 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /standard_name="PMC97140P1" /db_xref="UniSTS:273642" variation 238 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /replace="a" /replace="g" /db_xref="dbSNP:1138357" variation 281 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /replace="a" /replace="g" /db_xref="dbSNP:34505045" variation 299 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /replace="g" /replace="t" /db_xref="dbSNP:1138358" variation 427 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /replace="a" /replace="g" /db_xref="dbSNP:3826007" variation 533 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /replace="g" /replace="t" /db_xref="dbSNP:34080999" variation 541 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /replace="a" /replace="t" /db_xref="dbSNP:11555732" exon 603..887 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /inference="alignment:Splign:1.39.8" STS 626..782 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /standard_name="SHGC-64943" /db_xref="UniSTS:75641" STS 629..783 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /standard_name="STS-U27467" /db_xref="UniSTS:9263" STS 629..782 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /standard_name="RH68628" /db_xref="UniSTS:20301" STS 675..774 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /standard_name="D10S1618E" /db_xref="UniSTS:153925" STS 710..859 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /standard_name="SHGC-35552" /db_xref="UniSTS:8795" polyA_signal 861..866 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" polyA_site 885 /gene="BCL2A1" /gene_synonym="ACC-1; ACC-2; BCL2L5; BFL1; GRS; HBPA1" /note="19 A nucleotides" ORIGIN
agcctacgcacgaaagtgactaggaggaaggatattataaagtgatgcaaacagaaattccaccagcctccatgtatcatcatgtgtcataactcagtcaagctcagtgagcattctcagcacattgcctcaacagcttcaaggtgagccagctcaagactttgctctccaccaggcagaagatgacagactgtgaatttggatatatttacaggctggctcaggactatctgcagtgcgtcctacagataccacaacctggatcaggtccaagcaaaacgtccagagtgctacaaaatgttgcgttctcagtccaaaaagaagtggaaaagaatctgaagtcatgcttggacaatgttaatgttgtgtccgtagacactgccagaacactattcaaccaagtgatggaaaaggagtttgaagacggcatcattaactggggaagaattgtaaccatatttgcatttgaaggtattctcatcaagaaacttctacgacagcaaattgccccggatgtggatacctataaggagatttcatattttgttgcggagttcataatgaataacacaggagaatggataaggcaaaacggaggctgggaaaatggctttgtaaagaagtttgaacctaaatctggctggatgacttttctagaagttacaggaaagatctgtgaaatgctatctctcctgaagcaatactgttgaccagaaaggacactccatattgtgaaaccggcctaatttttctgactgatatggaaacgattgccaacacatacttctacttttaaataaacaactttgatgatgtaacttgaccttccagagttatggaaattttgtccccatgtaatgaataaattgtatgtatttttctctataaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:597 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:597 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:597 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IEA GeneID:597 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.