2024-04-20 04:05:56, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_003953 5026 bp mRNA linear PRI 14-APR-2013 DEFINITION Homo sapiens myelin protein zero-like 1 (MPZL1), transcript variant 1, mRNA. ACCESSION NM_003953 VERSION NM_003953.5 GI:226054531 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 5026) AUTHORS Cummings,A.C., Jiang,L., Velez Edwards,D.R., McCauley,J.L., Laux,R., McFarland,L.L., Fuzzell,D., Knebusch,C., Caywood,L., Reinhart-Mercer,L., Nations,L., Gilbert,J.R., Konidari,I., Tramontana,M., Cuccaro,M.L., Scott,W.K., Pericak-Vance,M.A. and Haines,J.L. TITLE Genome-wide association and linkage study in the Amish detects a novel candidate late-onset Alzheimer disease gene JOURNAL Ann. Hum. Genet. 76 (5), 342-351 (2012) PUBMED 22881374 REFERENCE 2 (bases 1 to 5026) AUTHORS Gallardo,E., Garcia,A., Ramon,C., Maravi,E., Infante,J., Gaston,I., Alonso,A., Combarros,O., De Jonghe,P. and Berciano,J. TITLE Charcot-Marie-Tooth disease type 2J with MPZ Thr124Met mutation: clinico-electrophysiological and MRI study of a family JOURNAL J. Neurol. 256 (12), 2061-2071 (2009) PUBMED 19629567 REMARK GeneRIF: Clinico-electrophysiological features and MRI findings are described in leg musculature from three patients belonging to a CMT2J pedigree due to MPZ Thr124Met mutation. REFERENCE 3 (bases 1 to 5026) AUTHORS Ehret,G.B., O'Connor,A.A., Weder,A., Cooper,R.S. and Chakravarti,A. TITLE Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study JOURNAL Eur. J. Hum. Genet. 17 (12), 1650-1657 (2009) PUBMED 19536175 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 4 (bases 1 to 5026) AUTHORS Cheung,C.L., Chan,B.Y., Chan,V., Ikegawa,S., Kou,I., Ngai,H., Smith,D., Luk,K.D., Huang,Q.Y., Mori,S., Sham,P.C. and Kung,A.W. TITLE Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation JOURNAL Hum. Mol. Genet. 18 (4), 679-687 (2009) PUBMED 19064610 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 5 (bases 1 to 5026) AUTHORS Kusano,K., Thomas,T.N. and Fujiwara,K. TITLE Phosphorylation and localization of protein-zero related (PZR) in cultured endothelial cells JOURNAL Endothelium 15 (3), 127-136 (2008) PUBMED 18568953 REMARK GeneRIF: Phosphorylation and localization of PZR in cultured endothelial cells is reported. REFERENCE 6 (bases 1 to 5026) AUTHORS Wistow,G., Bernstein,S.L., Wyatt,M.K., Fariss,R.N., Behal,A., Touchman,J.W., Bouffard,G., Smith,D. and Peterson,K. TITLE Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants JOURNAL Mol. Vis. 8, 205-220 (2002) PUBMED 12107410 REMARK Publication Status: Online-Only REFERENCE 7 (bases 1 to 5026) AUTHORS Zhao,R., Guerrah,A., Tang,H. and Zhao,Z.J. TITLE Cell surface glycoprotein PZR is a major mediator of concanavalin A-induced cell signaling JOURNAL J. Biol. Chem. 277 (10), 7882-7888 (2002) PUBMED 11751924 REMARK GeneRIF: PZR is a major receptor of ConA and has an important role in cell signaling via c-Src. Considering the various biological activities of ConA, the study of PZR may have major therapeutic implications REFERENCE 8 (bases 1 to 5026) AUTHORS Zhao,R. and Zhao,Z.J. TITLE Dissecting the interaction of SHP-2 with PZR, an immunoglobulin family protein containing immunoreceptor tyrosine-based inhibitory motifs JOURNAL J. Biol. Chem. 275 (8), 5453-5459 (2000) PUBMED 10681522 REFERENCE 9 (bases 1 to 5026) AUTHORS Tang,D.S., Yu,K.P., Tang,X.X., Zhang,H.L., Pan,Q., Dai,H.P. and Xia,J.H. TITLE Cloning of Human Myelin Protein Zero-like Genes by Bioinformatics Strategy JOURNAL Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 32 (4), 364-368 (2000) PUBMED 12075424 REFERENCE 10 (bases 1 to 5026) AUTHORS Zhao,Z.J. and Zhao,R. TITLE Purification and cloning of PZR, a binding protein and putative physiological substrate of tyrosine phosphatase SHP-2 JOURNAL J. Biol. Chem. 273 (45), 29367-29372 (1998) PUBMED 9792637 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DA725074.1, AY359019.1, Z99943.1 and AW292498.1. On Apr 1, 2009 this sequence version replaced gi:46358424. Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (a). Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK075334.1, AY359019.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-40 DA725074.1 1-40 41-1817 AY359019.1 1-1777 1818-4719 Z99943.1 65024-67925 4720-5026 AW292498.1 1-307 c FEATURES Location/Qualifiers source 1..5026 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="1" /map="1q24.2" gene 1..5026 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /note="myelin protein zero-like 1" /db_xref="GeneID:9019" /db_xref="HGNC:7226" /db_xref="HPRD:05086" /db_xref="MIM:604376" exon 1..293 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /inference="alignment:Splign:1.39.8" CDS 203..1012 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /note="isoform a precursor is encoded by transcript variant 1; protein zero related; myelin protein zero-like protein 1; immunoglobulin family transmembrane protein; protein zero-related" /codon_start=1 /product="myelin protein zero-like protein 1 isoform a precursor" /protein_id="NP_003944.1" /db_xref="GI:4506357" /db_xref="CCDS:CCDS1264.1" /db_xref="GeneID:9019" /db_xref="HGNC:7226" /db_xref="HPRD:05086" /db_xref="MIM:604376" /translation="
MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
" sig_peptide 203..307 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /inference="non-experimental evidence, no additional details recorded" /note="Potential; propagated from UniProtKB/Swiss-Prot (O95297.1)" mat_peptide 308..1009 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /product="Myelin protein zero-like protein 1" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (O95297.1)" misc_feature 317..664 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /note="Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins; Region: Ig_P0-like; cd05715" /db_xref="CDD:143192" misc_feature order(317..319,323..325,359..361,383..385,389..391, 515..517,524..526,569..574) /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /note="fourfold interface; other site" /db_xref="CDD:143192" misc_feature 326..664 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /note="Immunoglobulin V-set domain; Region: V-set; pfam07686" /db_xref="CDD:203725" misc_feature 689..751 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (O95297.1); transmembrane region" misc_feature 800..802 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="dephosphorylation site; modified site" /citation=[10] /db_xref="HPRD:01470" misc_feature 818..820 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" misc_feature 824..826 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (O95297.1); phosphorylation site" misc_feature 824..826 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" misc_feature 830..832 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (O95297.1); phosphorylation site" misc_feature 830..832 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" misc_feature 857..859 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (O95297.1); phosphorylation site" misc_feature 863..865 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (O95297.1); phosphorylation site" misc_feature 869..871 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" misc_feature 917..934 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (O95297.1); Region: ITIM motif 1" misc_feature 923..925 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="dephosphorylation site; modified site" /citation=[7] /citation=[8] /db_xref="HPRD:01470" misc_feature 923..925 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="Phosphotyrosine; propagated from UniProtKB/Swiss-Prot (O95297.1); phosphorylation site" misc_feature 923..925 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /citation=[7] /citation=[8] /db_xref="HPRD:01819" misc_feature 980..982 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (O95297.1); phosphorylation site" misc_feature 983..1000 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (O95297.1); Region: ITIM motif 2" misc_feature 989..991 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="dephosphorylation site; modified site" /citation=[7] /citation=[8] /db_xref="HPRD:01470" misc_feature 989..991 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="Phosphotyrosine; propagated from UniProtKB/Swiss-Prot (O95297.1); phosphorylation site" misc_feature 989..991 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /citation=[7] /citation=[8] /db_xref="HPRD:01819" variation 242 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:113319606" variation 243 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:368926182" exon 294..460 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /inference="alignment:Splign:1.39.8" variation 319 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:200435022" variation 338 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:369822857" variation 372 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:375713174" variation 397 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:150711804" variation 404 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:146968580" variation 415 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:143448673" variation 418 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:201705663" variation 450 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:369996563" exon 461..674 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /inference="alignment:Splign:1.39.8" variation 465 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:201193049" variation 484 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:375159380" variation 504 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:368816230" variation 586 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:371291585" variation 615 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:141242973" variation 619 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:150774030" variation 649 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:375912956" variation 665 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:367767112" exon 675..807 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /inference="alignment:Splign:1.39.8" variation 746 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="g" /db_xref="dbSNP:375340075" variation 747 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:368992613" variation 779 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="c" /db_xref="dbSNP:373029251" variation 799 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:200583957" exon 808..910 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /inference="alignment:Splign:1.39.8" variation 817 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:199586587" variation 830 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="t" /db_xref="dbSNP:372694435" variation 852 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:150906954" variation 897 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="c" /db_xref="dbSNP:201934009" exon 911..5010 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /inference="alignment:Splign:1.39.8" variation 933 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="g" /replace="t" /db_xref="dbSNP:146099511" variation 943 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:139028868" variation 947 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:146869026" variation 964..965 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="" /replace="t" /db_xref="dbSNP:34626910" STS 974..1130 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /standard_name="SHGC-75878" /db_xref="UniSTS:7599" variation 993 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:375874838" variation 994 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:200004895" variation 1002 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:190661858" variation 1024 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:377498586" variation 1147 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:141592237" variation 1183 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="g" /replace="t" /db_xref="dbSNP:150901710" variation 1198 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:78809449" variation 1293 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:182898542" variation 1294 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:185441444" variation 1337 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:190151302" variation 1462 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:41270734" variation 1596 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:182824572" STS 1623..1768 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /standard_name="RH12295" /db_xref="UniSTS:58576" variation 1700 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:112509046" variation 1710 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="c" /db_xref="dbSNP:187389510" variation 1805 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:193160724" variation 1811 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:138177732" variation 1813 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:183755663" variation 1872 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:73037892" variation 1877 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="g" /db_xref="dbSNP:114584283" variation 1891 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:115952869" variation 1914 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="t" /db_xref="dbSNP:72697779" variation 1922 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:149549702" variation 1934 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="g" /db_xref="dbSNP:370896138" variation 1943 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:193135489" variation 1952 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="g" /db_xref="dbSNP:147274411" variation 1971 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="" /replace="t" /db_xref="dbSNP:34678493" variation 2048 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:140780938" variation 2116 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:720612" variation 2127 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:113574305" variation 2157 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:147412044" variation 2175 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="c" /db_xref="dbSNP:183563193" variation 2190..2191 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="" /replace="a" /db_xref="dbSNP:35089441" variation 2233 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:12072200" variation 2280 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="g" /db_xref="dbSNP:186815046" variation 2291 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:7414295" variation 2361 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="c" /db_xref="dbSNP:191636295" variation 2374 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:184020611" variation 2376 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="t" /db_xref="dbSNP:189800509" variation 2396 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:182056523" variation 2409 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:185413057" variation 2505 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:10125" variation 2517 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:142735758" variation 2544 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:114704696" variation 2547..2551 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="" /replace="aagat" /db_xref="dbSNP:66529257" variation 2563 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:76940524" variation 2577 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:35215126" STS 2592..3427 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /standard_name="MPZL1__7200" /db_xref="UniSTS:466339" variation 2638 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:3752606" variation 2694 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:151009335" variation 2736 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="g" /replace="t" /db_xref="dbSNP:140712114" variation 2755 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:3088322" variation 2850 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:143124803" variation 2852 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="g" /db_xref="dbSNP:12745388" variation 2987 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:74388383" variation 2993 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="c" /db_xref="dbSNP:146700702" STS 3017..3091 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /standard_name="D1S1803E" /db_xref="UniSTS:150719" STS 3106..3243 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /standard_name="WI-12092" /db_xref="UniSTS:34243" STS 3107..3206 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /standard_name="D1S1795E" /db_xref="UniSTS:47740" variation 3130 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:190565454" variation 3135 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:7605" STS 3217..3972 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /standard_name="FLJ21047_2474" /db_xref="UniSTS:463588" STS 3267..3368 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /standard_name="RH36145" /db_xref="UniSTS:64757" variation 3273 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="g" /db_xref="dbSNP:11807657" variation 3374 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:181999887" variation 3427 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:14212" variation 3458..3461 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="" /replace="agtt" /db_xref="dbSNP:374021239" variation 3505 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:61995896" variation 3592 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="g" /db_xref="dbSNP:140274317" variation 3605 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:8917" variation 3692 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:8623" variation 3706 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:185284937" STS 3716..3829 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /standard_name="A007A43" /db_xref="UniSTS:35948" variation 3748 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:145325991" variation 3756 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:12316" variation 4019 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="g" /replace="t" /db_xref="dbSNP:12071420" variation 4043 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:189891170" variation 4050 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="g" /db_xref="dbSNP:148979779" variation 4163 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="g" /db_xref="dbSNP:113581119" variation 4252 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:148155475" variation 4279 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:141847648" variation 4324 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:368920044" variation 4376 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="g" /db_xref="dbSNP:10753763" variation 4423 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="g" /db_xref="dbSNP:76775177" variation 4460 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="c" /db_xref="dbSNP:371184482" variation 4489 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:35065671" variation 4545 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="t" /db_xref="dbSNP:139012766" variation 4575 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:181105938" variation 4585 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:10753764" variation 4601 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:186660095" variation 4654 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:191445959" variation 4660 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:183602418" variation 4661 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:10800323" variation 4742 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="a" /replace="g" /db_xref="dbSNP:188493549" variation 4827 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:143146901" variation 4924 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:192283907" variation 5007 /gene="MPZL1" /gene_synonym="MPZL1b; PZR; PZR1b; PZRa; PZRb" /replace="c" /replace="t" /db_xref="dbSNP:147481157" ORIGIN
agcgagggccggagtggggctgaggcttcggtgcagagctggagagccgcggctgggaccggagtggggagcgcggcgtggaggtgccacccggcgcgggtggcggagagatcagaagcctcttccccaagccgagccaacctcagcggggacccgggctcagggacgcggcggcggcggcggcgactgcagtggctggacgatggcagcgtccgccggagccggggcggtgattgcagccccagacagccggcgctggctgtggtcggtgctggcggcggcgcttgggctcttgacagctggagtatcagccttggaagtatatacgccaaaagaaatcttcgtggcaaatggtacacaagggaagctgacctgcaagttcaagtctactagtacgactggcgggttgacctcagtctcctggagcttccagccagagggggccgacactactgtgtcgtttttccactactcccaagggcaagtgtaccttgggaattatccaccatttaaagacagaatcagctgggctggagaccttgacaagaaagatgcatcaatcaacatagaaaatatgcagtttatacacaatggcacctatatctgtgatgtcaaaaaccctcctgacatcgttgtccagcctggacacattaggctctatgtcgtagaaaaagagaatttgcctgtgtttccagtttgggtagtggtgggcatagttactgctgtggtcctaggtctcactctgctcatcagcatgattctggctgtcctctatagaaggaaaaactctaaacgggattacactggctgcagtacatcagagagtttgtcaccagttaagcaggctcctcggaagtccccctccgacactgagggtcttgtaaagagtctgccttctggatctcaccagggcccagtcatatatgcacagttagaccactccggcggacatcacagtgacaagattaacaagtcagagtctgtggtgtatgcggatatccgaaagaattaagagaatacctagaacatatcctcagcaagaaacaaaaccaaactggactctcgtgcagaaaatgtagcccattaccacatgtagccttggagacccaggcaaggacaagtacacgtgtactcacagagggagagaaagatgtgtacaaaggatatgtataaatattctatttagtcatcctgatatgaggagccagtgttgcatgatgaaaagatggtatgattctacatatgtacccattgtcttgctgtttttgtactttcttttcaggtcatttacaattgggagatttcagaaacattcctttcaccatcatttagaaatggtttgccttaatggagacaatagcagatcctgtagtatttccagtagacatggccttttaatctaagggcttaagactgattagtcttagcatttactgtagttggaggatggagatgctatgatggaagcatacccagggtggcctttagcacagtatcagtaccatttatttgtctgccgcttttaaaaaatacccattggctatgccacttgaaaacaatttgagaagtttttttgaagtttttctcactaaaatatggggcaattgttagccttacatgttgtgtagacttactttaagtttgcacccttgaaatgtgtcatatcaatttctggattcataatagcaagattagcaaaggataaatgccgaaggtcacttcattctggacacagttggatcaatactgattaagtagaaaatccaagctttgcttgagaacttttgtaacgtggagagtaaaaagtatcggttttattctttgctgatgtcctttctgcttgaaataacagtcaccatacagctaaaggagaggagtttctttccttctaagtaggcagaaatggtatcattatgttgccgctctccaatctcccagagctcgctctctagagaatcaccttctttcgcttttttttttttttttgaggtagagtctcactatgttgcccagactagccttgaactcttgggctcaagtgattctccctcctcagcctcccgagtagctggaacgaactatagttgcaccactgcagctggcaagaatcaccttctttataaagcgtcagtcatgcttccagcaagaggcagcatcagtcatggctttataacagcttcatggtgcctcaaagactgttgaggttaatgagagcctagattagacagtttggctgtccttccctaaaacttgttttctcctattcactactccccaccgcacttaaaatctatgagtttttactttttactgggaatggaaagtgtggtgaagatcattcaacacttatgttgtcatttctcccattttctgaatttttttttaaatttccccccttttaaaattgttcgaaagcccacagttatggaaagaattactgtctagatggtctgcagaacgtgtttggggtgagtgggagtgaggggcaatgttactttttctccctgtagtttggagtccattatgagctgctgctttttcttctcatcttgtcatcttctggggatgtttgaaggctgagttccaacagaattcacaaagggaataaaacaggattgagattttgaggtgtgcacaaggtggtaagataaagggcatatgagcttcaaaactaatgctgttgcatacatgaagccttttgttttttgaggagctatttttgttattcttgtaacgctccaccttacatgccacatctgtgtgagtcaacagggatcaggtttggtcaccacacatgtctgaagctgggcagcgtctgctctgtgttctgtgtggaatggagaaaaaaacgcctgccctgctgccttccatgttcataggcccagcccaagagagtgacacacagtgctggccctgagacatttccacaaagtggtcaactctgccttgcatcctaaaactttttgggcatctattttgaaaactataggagcctttggaaggcctcttatgtttggaggggaagggtgttgagattgtcaccatccttcaagctgagactcctggtgagcctttgccaccatgaaaaccacatagctgaccagggctgtgcttgaggtacagaggacacacattgtagacaggcctgtgtcatgtttccttacagtcgttttttacagagaaaaggggcattgttttttcactgctttctcaacagttcctgtgaataaatgaaacatttcggagctccctgagagcaagagccttcacttcttcttgcggtgccgggaccatgtgttggtgaagctggtgctgtgggggccactcactcgaatgacacctggaggcctgttcctcccttaccactcccttccccagcccgacttcttggcctcctgcccaaccagacacctcaaactctgtcagtgccctggcattctggcagagaatcctcaccagttctcaccaaccttccccccaggcaagggcagctgccagcatggtgctctgccaggacaggtttccctgaaggaagctgctcacactgagatgagcctctcagggcaggacctcttcccaagccctgcacacccacccctgcagcccttttggctccccttttccctgtgcctcagcactcctttcctggttgcagataacgaactaaggttgcctaaagggcagatctgccctctccatgtcttcgtcctggcaaacagggtcgtcttaaaattatgcgctaattctgtatgggagcactcaaaaggcattacttagagattgaaatttcaaactatctctagtttttcaatggaaatatatcagctagggaaaaaccatcaagctcattattattttttgatcttcagttgtatttttgtgaatattttaatacatctttttcaatttctgaattgtgttgtgtgctcattttgaccagaatagaaaaagagatatgcctttcactcatatcattccagctacacctgccttcttttcttcaaaaatgccgtccgtgtgcctgcttctgggcctttgcacatgctgttccctgggcctgaagcatgccttctgccaatattcctgtggtttgctctctgacttcctttaagcctctgctcaaatgttacctcctcagggagaccttctgtgatatataaaagagcaagccccccaccccaccgcctcagccttcctggccccctcagttctgctctagttactctatttctctccctctttcccagtacacacttgtctgttctcccgcattagaacatagttaacaagagaccagaaccttgctgttttgttcactgctccgtctgcagtaaagggaacagcacctggcacttagctgctcaatacatgttacgtggatggatgagtaggtggaagcattcatccattcagcaacctacactgagaacaatcctgtgccaagcactgtgctaagcataaggaaacaaaacaagacaaagctcctcaaggagcttgccacagggtggaggtgacaggtgacatgaatggaagtaactagtagttaccaaatacttggtgtgagccaggcactttgcatttctttctctattatttctgtgagttaacagtaattgtactaatcttaatcccattgtttgaaagattatatggcttacccagggccacttagctaataaaggaacagagaagaggggctgggcctggggccgctgtttgatccacagccttgttcctaaccactatgccctgtggcctctcacaccaaaaggaagtaccaaactgcttccttactcaaataaatgtgctgaaatgcagttgcagttttctcccagtcccttaggagctggttagagagtcccttaggaacttgagagggtagtgtagtctaggtggtaggcacagatgtctgagagctttaacctcagtctggaagacaatgtggtgacttaatttgttgagaactatgttacaaataatgtgttactaataaaacattgaggcttcgcaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:9019 -> Molecular function: GO:0005198 [structural molecule activity] evidence: TAS GeneID:9019 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:9019 -> Biological process: GO:0007169 [transmembrane receptor protein tyrosine kinase signaling pathway] evidence: TAS GeneID:9019 -> Biological process: GO:0007267 [cell-cell signaling] evidence: TAS GeneID:9019 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.