Home |
Help |
Advanced search
2024-04-26 16:31:24, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_003897 1254 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens immediate early response 3 (IER3), mRNA.
ACCESSION NM_003897
VERSION NM_003897.3 GI:119964722
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1254)
AUTHORS Han,L., Geng,L., Liu,X., Shi,H., He,W. and Wu,M.X.
TITLE Clinical significance of IEX-1 expression in ovarian carcinoma
JOURNAL Ultrastruct Pathol 35 (6), 260-266 (2011)
PUBMED 22085302
REMARK GeneRIF: Altered IEX-1 expression can potentially be a new
predictor of the malignant transformation and a prognostic
indicator for cancer therapy.
REFERENCE 2 (bases 1 to 1254)
AUTHORS Ishimoto,Y., Satsu,H., Totsuka,M. and Shimizu,M.
TITLE IEX-1 suppresses apoptotic damage in human intestinal epithelial
Caco-2 cells induced by co-culturing with macrophage-like THP-1
cells
JOURNAL Biosci. Rep. 31 (5), 345-351 (2011)
PUBMED 21250941
REMARK GeneRIF: IEX-1 plays a role in suppression of apoptosis and
protects cells by controlling sensitivity to TNFalpha under both
normal and inflammatory conditions.
REFERENCE 3 (bases 1 to 1254)
AUTHORS Arlt,A. and Schafer,H.
TITLE Role of the immediate early response 3 (IER3) gene in cellular
stress response, inflammation and tumorigenesis
JOURNAL Eur. J. Cell Biol. 90 (6-7), 545-552 (2011)
PUBMED 21112119
REMARK GeneRIF: IER3 plays a complex and to some extent contradictory role
in cell cycle control and apoptosis. Effects of IER3 relate to an
interference with certain signalling pathways
Review article
REFERENCE 4 (bases 1 to 1254)
AUTHORS Li,X.Y., Shen,J.Z., Shen,S.F., Fu,H.Y., Zhou,H.R., Wu,D.S.,
Zhang,Y.Y. and Zheng,Y.Q.
TITLE [Methylation status of IEX-1 gene promotor CpG island in malignant
hematopoietic cell lines]
JOURNAL Zhongguo Shi Yan Xue Ye Xue Za Zhi 19 (2), 473-476 (2011)
PUBMED 21518511
REMARK GeneRIF: Changes of methylation status of gene IEX-1 promoter CpG
island correlates with hematologic malignancies.
REFERENCE 5 (bases 1 to 1254)
AUTHORS Wang,Y., Li,Y., Fan,X., Zhang,Y., Wu,J. and Zhao,Z.
TITLE Early proliferation alteration and differential gene expression in
human periodontal ligament cells subjected to cyclic tensile stress
JOURNAL Arch. Oral Biol. 56 (2), 177-186 (2011)
PUBMED 20934684
REMARK GeneRIF: IER3 is upregulated in human PDLCs subjected to tensile
stress related to mechano-induced cell cycle arrest.
REFERENCE 6 (bases 1 to 1254)
AUTHORS Wu,M.X., Ao,Z., Prasad,K.V., Wu,R. and Schlossman,S.F.
TITLE IEX-1L, an apoptosis inhibitor involved in NF-kappaB-mediated cell
survival
JOURNAL Science 281 (5379), 998-1001 (1998)
PUBMED 9703517
REFERENCE 7 (bases 1 to 1254)
AUTHORS Pietzsch,A., Buchler,C. and Schmitz,G.
TITLE Genomic organization, promoter cloning, and chromosomal
localization of the Dif-2 gene
JOURNAL Biochem. Biophys. Res. Commun. 245 (3), 651-657 (1998)
PUBMED 9588170
REFERENCE 8 (bases 1 to 1254)
AUTHORS Pietzsch,A., Buchler,C., Aslanidis,C. and Schmitz,G.
TITLE Identification and characterization of a novel monocyte/macrophage
differentiation-dependent gene that is responsive to
lipopolysaccharide, ceramide, and lysophosphatidylcholine
JOURNAL Biochem. Biophys. Res. Commun. 235 (1), 4-9 (1997)
PUBMED 9196025
REFERENCE 9 (bases 1 to 1254)
AUTHORS Schafer,H., Trauzold,A., Siegel,E.G., Folsch,U.R. and Schmidt,W.E.
TITLE PRG1: a novel early-response gene transcriptionally induced by
pituitary adenylate cyclase activating polypeptide in a pancreatic
carcinoma cell line
JOURNAL Cancer Res. 56 (11), 2641-2648 (1996)
PUBMED 8653710
REFERENCE 10 (bases 1 to 1254)
AUTHORS Kondratyev,A.D., Chung,K.N. and Jung,M.O.
TITLE Identification and characterization of a radiation-inducible
glycosylated human early-response gene
JOURNAL Cancer Res. 56 (7), 1498-1502 (1996)
PUBMED 8603392
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DA893782.1, BC000844.2 and
BM915952.1.
On Dec 27, 2006 this sequence version replaced gi:16554595.
Summary: This gene functions in the protection of cells from Fas-
or tumor necrosis factor type alpha-induced apoptosis. Partially
degraded and unspliced transcripts are found after virus infection
in vitro, but these transcripts are not found in vivo and do not
generate a valid protein. [provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC000844.2, BC005080.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-16 DA893782.1 2-17
17-410 BC000844.2 1-394
411-778 BM915952.1 416-783
779-1254 BC000844.2 763-1238
FEATURES Location/Qualifiers
source 1..1254
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="6"
/map="6p21.3"
gene 1..1254
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/note="immediate early response 3"
/db_xref="GeneID:8870"
/db_xref="HGNC:5392"
/db_xref="MIM:602996"
exon 1..242
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/inference="alignment:Splign:1.39.8"
variation 1
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/replace="c"
/replace="t"
/db_xref="dbSNP:2301277"
CDS 33..503
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/note="immediately early gene X-1; gly96, mouse, homolog
of; anti-death protein; expressed in pancreatic carcinoma;
protein DIF-2; immediate early protein GLY96;
PACAP-responsive gene 1 protein; immediate early response
3 protein; differentiation-dependent gene 2 protein"
/codon_start=1
/product="radiation-inducible immediate-early gene IEX-1"
/protein_id="NP_003888.2"
/db_xref="GI:119964723"
/db_xref="CCDS:CCDS4689.1"
/db_xref="GeneID:8870"
/db_xref="HGNC:5392"
/db_xref="MIM:602996"
/translation="
MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASLAPTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF
"
misc_feature 84..86
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine, by MAPK1; propagated from
UniProtKB/Swiss-Prot (P46695.4); phosphorylation site"
misc_feature 84..86
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01496"
misc_feature 123..125
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P46695.4); phosphorylation site"
misc_feature 279..329
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P46695.4);
transmembrane region"
misc_feature 399..401
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine, by MAPK1; propagated from
UniProtKB/Swiss-Prot (P46695.4); phosphorylation site"
misc_feature 408..410
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by MAPK1; propagated from
UniProtKB/Swiss-Prot (P46695.4); phosphorylation site"
STS 125..309
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/standard_name="PMC154982P3"
/db_xref="UniSTS:271319"
variation 193
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/replace="c"
/replace="t"
/db_xref="dbSNP:3177809"
exon 243..1240
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/inference="alignment:Splign:1.39.8"
variation 411
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/replace="c"
/replace="g"
/db_xref="dbSNP:3094124"
STS 495..620
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/standard_name="RH78215"
/db_xref="UniSTS:49214"
variation 859
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/replace="c"
/replace="t"
/db_xref="dbSNP:8512"
variation 881
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/replace="c"
/replace="t"
/db_xref="dbSNP:14350"
STS 924..1095
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/standard_name="RH91431"
/db_xref="UniSTS:91128"
STS 928..1078
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/standard_name="PMC154982P2"
/db_xref="UniSTS:271318"
STS 1059..1208
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/standard_name="STS-AA034911"
/db_xref="UniSTS:25395"
STS 1093..1214
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/standard_name="G62116"
/db_xref="UniSTS:139159"
variation 1100
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/replace="a"
/replace="t"
/db_xref="dbSNP:1802172"
variation 1149
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/replace="a"
/replace="g"
/db_xref="dbSNP:1049942"
variation 1190
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
/replace="c"
/replace="g"
/db_xref="dbSNP:1049943"
polyA_signal 1217..1222
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
polyA_site 1240
/gene="IER3"
/gene_synonym="DIF-2; DIF2; GLY96; IEX-1; IEX-1L; IEX1;
PRG1"
ORIGIN
ctcacttggccttacactccgctcggctcaccatgtgtcactctcgcagctgccacccgaccatgaccatcctgcaggccccgaccccggccccctccaccatcccgggaccccggcggggctccggtcctgagatcttcaccttcgaccctctcccggagcccgcagcggcccctgccgggcgccccagcgcctctcgcgggcaccgaaagcgcagccgcagggttctctaccctcgagtggtccggcgccagctgccagtcgaggaaccgaacccagccaaaaggcttctctttctgctgctcaccatcgtcttctgccagatcctgatggctgaagagggtgtgccggcgcccctgcctccagaggacgcccctaacgccgcatccctggcgcccacccctgtgtccgccgtcctcgagccctttaatctgacttcggagccctcggactacgctctggacctcagcactttcctccagcaacacccggccgccttctaactgtgactccccgcactccccaaaaagaatccgaaaaaccacaaagaaacaccaggcgtacctggtgcgcgagagcgtatccccaactgggacttccgaggcaacttgaactcagaacactacagcggagacgccacccggtgcttgaggcgggaccgaggcgcacagagaccgaggcgcatagagaccgaggcacagcccagctggggctaggcccggtgggaaggagagcgtcgttaatttatttcttattgctcctaattaatatttatatgtatttatgtacgtcctcctaggtgatggagatgtgtacgtaatatttattttaacttatgcaagggtgtgagatgttccccctgctgtaaatgcaggtctcttggtatttattgagctttgtgggactggtggaagcaggacacctggaactgcggcaaagtaggagaagaaatggggaggactcgggtgggggaggacgtcccggctgggatgaagtctggtggtgggtcgtaagtttaggaggtgactgcatcctccagcatctcaactccgtctgtctactgtgtgagacttcggcggaccattaggaatgagatccgtgagatccttccatcttcttgaagtcgcctttagggtggctgcgaggtagagggttgggggttggtgggctgtcacggagcgactgtcgagatcgcctagtatgttctgtgaacacaaataaaattgatttactgtctgcaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:8870 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:8870 -> Biological process: GO:0000075 [cell cycle checkpoint] evidence: IEA
GeneID:8870 -> Biological process: GO:0001562 [response to protozoan] evidence: IEA
GeneID:8870 -> Biological process: GO:0003085 [negative regulation of systemic arterial blood pressure] evidence: IEA
GeneID:8870 -> Biological process: GO:0006282 [regulation of DNA repair] evidence: IEA
GeneID:8870 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:8870 -> Biological process: GO:0009653 [anatomical structure morphogenesis] evidence: TAS
GeneID:8870 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IEA
GeneID:8870 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IEA
GeneID:8870 -> Biological process: GO:0045732 [positive regulation of protein catabolic process] evidence: IEA
GeneID:8870 -> Biological process: GO:0045820 [negative regulation of glycolysis] evidence: IEA
GeneID:8870 -> Biological process: GO:0046822 [regulation of nucleocytoplasmic transport] evidence: IEA
GeneID:8870 -> Biological process: GO:0050728 [negative regulation of inflammatory response] evidence: IEA
GeneID:8870 -> Biological process: GO:2000377 [regulation of reactive oxygen species metabolic process] evidence: IEA
GeneID:8870 -> Biological process: GO:2001020 [regulation of response to DNA damage stimulus] evidence: IMP
GeneID:8870 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:8870 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.