2025-07-16 04:39:58, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_003865 1182 bp mRNA linear PRI 09-JUN-2013 DEFINITION Homo sapiens HESX homeobox 1 (HESX1), mRNA. ACCESSION NM_003865 VERSION NM_003865.2 GI:171184419 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1182) AUTHORS Vivenza,D., Godi,M., Faienza,M.F., Mellone,S., Moia,S., Rapa,A., Petri,A., Bellone,S., Riccomagno,S., Cavallo,L., Giordano,M. and Bona,G. TITLE A novel HESX1 splice mutation causes isolated GH deficiency by interfering with mRNA processing JOURNAL Eur. J. Endocrinol. 164 (5), 705-713 (2011) PUBMED 21325470 REMARK GeneRIF: A c.357+3G>A mutation prevents the generation of one of the alternative isoforms normally produced by the wild-type allele, predicting a truncated HESX1 protein. REFERENCE 2 (bases 1 to 1182) AUTHORS Reynaud,R., Albarel,F., Saveanu,A., Kaffel,N., Castinetti,F., Lecomte,P., Brauner,R., Simonin,G., Gaudart,J., Carmona,E., Enjalbert,A., Barlier,A. and Brue,T. TITLE Pituitary stalk interruption syndrome in 83 patients: novel HESX1 mutation and severe hormonal prognosis in malformative forms JOURNAL Eur. J. Endocrinol. 164 (4), 457-465 (2011) PUBMED 21270112 REMARK GeneRIF: A novel HESX1 causative mutation was found in a consanguineous family, and two LHX4 mutations were present in familial Pituitary stalk interruption syndrome. REFERENCE 3 (bases 1 to 1182) AUTHORS Mellado,C., Poduri,A., Gleason,D., Elhosary,P.C., Barry,B.J., Partlow,J.N., Chang,B.S., Shaw,G.M., Barkovich,A.J. and Walsh,C.A. TITLE Candidate gene sequencing of LHX2, HESX1, and SOX2 in a large schizencephaly cohort JOURNAL Am. J. Med. Genet. A 152A (11), 2736-2742 (2010) PUBMED 20949537 REMARK GeneRIF: A large cohort of patients with schizencephaly, some with features of septo-optic dysplasia, were sequenced for mutations in LHX2, HESX1 and SOX2. REFERENCE 4 (bases 1 to 1182) AUTHORS Campanini,M.L., Colli,L.M., Paixao,B.M., Cabral,T.P., Amaral,F.C., Machado,H.R., Neder,L.S., Saggioro,F., Moreira,A.C., Antonini,S.R. and de Castro,M. TITLE CTNNB1 gene mutations, pituitary transcription factors, and MicroRNA expression involvement in the pathogenesis of adamantinomatous craniopharyngiomas JOURNAL Horm Cancer 1 (4), 187-196 (2010) PUBMED 21761366 REMARK GeneRIF: Data show no mutations in HESX1, PROP1, and POU1F1 genes, seven different mutations in CTNNB1 in 8/16 patients, and hyperexpression of miR-150. REFERENCE 5 (bases 1 to 1182) AUTHORS Cruz,J.B., Nunes,V.S., Clara,S.A., Perone,D., Kopp,P. and Nogueira,C.R. TITLE Molecular analysis of the PROP1 and HESX1 genes in patients with septo-optic dysplasia and/or pituitary hormone deficiency JOURNAL Arq Bras Endocrinol Metabol 54 (5), 482-487 (2010) PUBMED 20694410 REMARK GeneRIF: Mutations in the PROP1 and HESX1 genes were not identified in these patients with sporadic growth hormone defiency, combined pituitary hormone deficiency and septo-optic dysplasia. REFERENCE 6 (bases 1 to 1182) AUTHORS Thomas,P.Q., Dattani,M.T., Brickman,J.M., McNay,D., Warne,G., Zacharin,M., Cameron,F., Hurst,J., Woods,K., Dunger,D., Stanhope,R., Forrest,S., Robinson,I.C. and Beddington,R.S. TITLE Heterozygous HESX1 mutations associated with isolated congenital pituitary hypoplasia and septo-optic dysplasia JOURNAL Hum. Mol. Genet. 10 (1), 39-45 (2001) PUBMED 11136712 REFERENCE 7 (bases 1 to 1182) AUTHORS Dattani,M.T., Martinez-Barbera,J.P., Thomas,P.Q., Brickman,J.M., Gupta,R., Martensson,I.L., Toresson,H., Fox,M., Wales,J.K., Hindmarsh,P.C., Krauss,S., Beddington,R.S. and Robinson,I.C. TITLE Mutations in the homeobox gene HESX1/Hesx1 associated with septo-optic dysplasia in human and mouse JOURNAL Nat. Genet. 19 (2), 125-133 (1998) PUBMED 9620767 REFERENCE 8 (bases 1 to 1182) AUTHORS Kazanskaya,O.V., Severtzova,E.A., Barth,K.A., Ermakova,G.V., Lukyanov,S.A., Benyumov,A.O., Pannese,M., Boncinelli,E., Wilson,S.W. and Zaraisky,A.G. TITLE Anf: a novel class of vertebrate homeobox genes expressed at the anterior end of the main embryonic axis JOURNAL Gene 200 (1-2), 25-34 (1997) PUBMED 9373136 REFERENCE 9 (bases 1 to 1182) AUTHORS Wales,J.K. and Quarrell,O.W. TITLE Evidence for possible Mendelian inheritance of septo-optic dysplasia JOURNAL Acta Paediatr. 85 (3), 391-392 (1996) PUBMED 8696006 REFERENCE 10 (bases 1 to 1182) AUTHORS Thomas,P.Q., Johnson,B.V., Rathjen,J. and Rathjen,P.D. TITLE Sequence, genomic organization, and expression of the novel homeobox gene Hesx1 JOURNAL J. Biol. Chem. 270 (8), 3869-3875 (1995) PUBMED 7876132 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC093928.2, BC112089.1 and AI652412.1. This sequence is a reference standard in the RefSeqGene project. On Mar 28, 2008 this sequence version replaced gi:4504366. Summary: This gene encodes a conserved homeobox protein that is a transcriptional repressor in the developing forebrain and pituitary gland. Mutations in this gene are associated with septooptic dysplasia, HESX1-related growth hormone deficiency, and combined pituitary hormone deficiency. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC093979.1, EL736199.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025083, ERS025084 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-288 AC093928.2 29719-30006 c 289-950 BC112089.1 1-662 951-1182 AI652412.1 1-232 c FEATURES Location/Qualifiers source 1..1182 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="3" /map="3p14.3" gene 1..1182 /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" /note="HESX homeobox 1" /db_xref="GeneID:8820" /db_xref="HGNC:4877" /db_xref="HPRD:03482" /db_xref="MIM:601802" exon 1..491 /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" /inference="alignment:Splign:1.39.8" variation 59 /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" /replace="g" /replace="t" /db_xref="dbSNP:983243" misc_feature 245..247 /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" /note="upstream in-frame stop codon" STS 266..892 /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" /db_xref="UniSTS:480628" STS 289..950 /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" /db_xref="UniSTS:483477" CDS 335..892 /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" /note="homeobox, ES cell expressed 1; Rathke pouch homeobox; hAnf; homeobox protein ANF" /codon_start=1 /product="homeobox expressed in ES cells 1" /protein_id="NP_003856.1" /db_xref="GI:4504367" /db_xref="CCDS:CCDS2881.1" /db_xref="GeneID:8820" /db_xref="HGNC:4877" /db_xref="HPRD:03482" /db_xref="MIM:601802" /translation="
MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE
" misc_feature 659..835 /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:28970" misc_feature order(659..673,677..679,728..730,746..748,785..787, 791..796,803..808,812..820,824..829) /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:28970" misc_feature order(665..667,674..676,794..796,803..808,815..817) /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:28970" exon 492..691 /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" /inference="alignment:Splign:1.39.8" exon 692..793 /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" /inference="alignment:Splign:1.39.8" exon 794..1173 /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" /inference="alignment:Splign:1.39.8" STS 928..1062 /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" /standard_name="RH48343" /db_xref="UniSTS:58053" polyA_signal 1150..1155 /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" polyA_site 1173 /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" ORIGIN
ccacatttgtgcatcacttctttagagaaagttaagtctgtgttctgcttaggagagataacactttttgtccctgtaggtggcccccctggtgtagccattagttgctaattacttgcaaacaaataaacaattaactccttaagctgctggctgggcaagtgttcattgacatgctaaaactttctaagacaggattttaattagtgacgttctaaatccagcccccttgtcagcggagctataaggtgaactgcaggaagatcccagccctatacacgtggggcagagccagcagaggccagagctgttgctctgtgcagaccacgagaggatgtctcccagccttcaggaaggcgctcagctcggggaaaacaaaccctcaacttgctccttttcaattgagagaatcttaggactggaccagaagaaagactgtgttccattaatgaaaccccacaggccctgggcagacacctgcagctcatcagggaaagatggtaacttatgtctacatgtcccaaatcctcccagtgggatttcattccctagcgtggtggatcacccaatgccagaagaaagagcttcgaaatatgaaaattacttttcagcctcagaaagactgtctttgaaaagagagttgagttggtatagaggccgaagaccaagaactgcttttactcaaaaccagattgaagtgttagaaaatgtctttagagtaaactgctatcctggtatcgatattagagaagacttagctcaaaaattgaatctagaggaagacagaatccagatttggtttcaaaatcggcgtgcaaaactgaaaaggtcccatagagaatcacagtttctaatggcgaaaaaaaatttcaacacaaatctgctggaatagatagaaaactaaacaagtgaaattatcttctaattgcagagcatgaagaatcagtggaaatattaagtgttaaaatgtgatgttttctttcctgcatttaatctgaatattgtcattttttctgaaaatatattgtaaatactattatagcatggtacatatttgggcacttttagttatagtaaagaccttttatatatattttaataaacattttcagaaaagattgctattttttaagtaagccaaattaatctaataaattagtttgttaaaatcaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:8820 -> Molecular function: GO:0003677 [DNA binding] evidence: TAS GeneID:8820 -> Molecular function: GO:0003682 [chromatin binding] evidence: IEA GeneID:8820 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA GeneID:8820 -> Molecular function: GO:0008022 [protein C-terminus binding] evidence: IEA GeneID:8820 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA GeneID:8820 -> Molecular function: GO:0047485 [protein N-terminus binding] evidence: IEA GeneID:8820 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA GeneID:8820 -> Biological process: GO:0007420 [brain development] evidence: TAS GeneID:8820 -> Biological process: GO:0030916 [otic vesicle formation] evidence: IEA GeneID:8820 -> Biological process: GO:0043584 [nose development] evidence: IEA GeneID:8820 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: IEA GeneID:8820 -> Biological process: GO:0048853 [forebrain morphogenesis] evidence: IEA GeneID:8820 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.