Home |
Help |
Advanced search
2024-04-25 20:13:22, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_003824 1855 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens Fas (TNFRSF6)-associated via death domain (FADD),
mRNA.
ACCESSION NM_003824
VERSION NM_003824.3 GI:215820647
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1855)
AUTHORS Oh,J. and Malter,J.S.
TITLE Pin1-FADD interactions regulate Fas-mediated apoptosis in activated
eosinophils
JOURNAL J. Immunol. 190 (10), 4937-4945 (2013)
PUBMED 23606538
REMARK GeneRIF: data show that Pin1 prevents Fas-mediated apoptosis in
activated eosinophils via interactions with phospho-FADD
REFERENCE 2 (bases 1 to 1855)
AUTHORS Park,Y.H., Jeong,M.S., Park,H.H. and Jang,S.B.
TITLE Formation of the death domain complex between FADD and RIP1
proteins in vitro
JOURNAL Biochim. Biophys. Acta 1834 (1), 292-300 (2013)
PUBMED 22922561
REMARK GeneRIF: Formation of the death domain complex between FADD and
RIP1 proteins in vitro
REFERENCE 3 (bases 1 to 1855)
AUTHORS Yoshimoto,M.
TITLE [Detection of FADD gene amplification in oral leukoplakia]
JOURNAL Kokubyo Gakkai Zasshi 79 (2), 71-81 (2012)
PUBMED 22838074
REMARK GeneRIF: The FADD gene amplification was not useful for the
predictive marker of cancerization but is possibly related to the
malignancy of oral squamous cell carcinoma.
REFERENCE 4 (bases 1 to 1855)
AUTHORS Grunert,M., Gottschalk,K., Kapahnke,J., Gundisch,S., Kieser,A. and
Jeremias,I.
TITLE The adaptor protein FADD and the initiator caspase-8 mediate
activation of NF-kappaB by TRAIL
JOURNAL Cell Death Dis 3, E414 (2012)
PUBMED 23096115
REMARK GeneRIF: FADD and the initiator caspase-8 mediate activation of
NF-kappaB by TRAIL.
Publication Status: Online-Only
REFERENCE 5 (bases 1 to 1855)
AUTHORS Lee,E.W., Kim,J.H., Ahn,Y.H., Seo,J., Ko,A., Jeong,M., Kim,S.J.,
Ro,J.Y., Park,K.M., Lee,H.W., Park,E.J., Chun,K.H. and Song,J.
TITLE Ubiquitination and degradation of the FADD adaptor protein regulate
death receptor-mediated apoptosis and necroptosis
JOURNAL Nat Commun 3, 978 (2012)
PUBMED 22864571
REMARK GeneRIF: Ubiquitination and degradation of the FADD adaptor protein
regulate death receptor-mediated apoptosis and necroptosis.
REFERENCE 6 (bases 1 to 1855)
AUTHORS Kim,P.K., Dutra,A.S., Chandrasekharappa,S.C. and Puck,J.M.
TITLE Genomic structure and mapping of human FADD, an intracellular
mediator of lymphocyte apoptosis
JOURNAL J. Immunol. 157 (12), 5461-5466 (1996)
PUBMED 8955195
REFERENCE 7 (bases 1 to 1855)
AUTHORS Boldin,M.P., Goncharov,T.M., Goltsev,Y.V. and Wallach,D.
TITLE Involvement of MACH, a novel MORT1/FADD-interacting protease, in
Fas/APO-1- and TNF receptor-induced cell death
JOURNAL Cell 85 (6), 803-815 (1996)
PUBMED 8681376
REFERENCE 8 (bases 1 to 1855)
AUTHORS Hsu,H., Shu,H.B., Pan,M.G. and Goeddel,D.V.
TITLE TRADD-TRAF2 and TRADD-FADD interactions define two distinct TNF
receptor 1 signal transduction pathways
JOURNAL Cell 84 (2), 299-308 (1996)
PUBMED 8565075
REFERENCE 9 (bases 1 to 1855)
AUTHORS Chinnaiyan,A.M., O'Rourke,K., Tewari,M. and Dixit,V.M.
TITLE FADD, a novel death domain-containing protein, interacts with the
death domain of Fas and initiates apoptosis
JOURNAL Cell 81 (4), 505-512 (1995)
PUBMED 7538907
REFERENCE 10 (bases 1 to 1855)
AUTHORS Boldin,M.P., Varfolomeev,E.E., Pancer,Z., Mett,I.L., Camonis,J.H.
and Wallach,D.
TITLE A novel protein that interacts with the death domain of Fas/APO1
contains a sequence motif related to the death domain
JOURNAL J. Biol. Chem. 270 (14), 7795-7798 (1995)
PUBMED 7536190
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AL575732.1, AP000879.4,
BC000334.2 and AI886015.1.
This sequence is a reference standard in the RefSeqGene project.
On Dec 5, 2008 this sequence version replaced gi:22219473.
Summary: The protein encoded by this gene is an adaptor molecule
that interacts with various cell surface receptors and mediates
cell apoptotic signals. Through its C-terminal death domain, this
protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis
factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it
participates in the death signaling initiated by these receptors.
Interaction of this protein with the receptors unmasks the
N-terminal effector domain of this protein, which allows it to
recruit caspase-8, and thereby activate the cysteine protease
cascade. Knockout studies in mice also suggest the importance of
this protein in early T cell development. [provided by RefSeq, Jul
2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AL575732.1, BC000334.2 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025082, ERS025084 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-27 AL575732.1 1-27
28-28 AP000879.4 128736-128736
29-627 AL575732.1 29-627
628-1471 BC000334.2 476-1319
1472-1831 BC000334.2 1323-1682
1832-1832 AP000879.4 132927-132927
1833-1855 AI886015.1 1-23 c
FEATURES Location/Qualifiers
source 1..1855
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="11"
/map="11q13.3"
gene 1..1855
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/note="Fas (TNFRSF6)-associated via death domain"
/db_xref="GeneID:8772"
/db_xref="HGNC:3573"
/db_xref="HPRD:03909"
/db_xref="MIM:602457"
exon 1..583
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/inference="alignment:Splign:1.39.8"
variation 28
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:7126976"
variation 58
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:41268207"
variation 107
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="t"
/db_xref="dbSNP:182810499"
misc_feature 118..120
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/note="upstream in-frame stop codon"
variation 133
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="g"
/db_xref="dbSNP:146764728"
variation 166
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:374436048"
variation 183
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="g"
/replace="t"
/db_xref="dbSNP:41268209"
variation 255
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:1131677"
variation 263
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:377137267"
variation 264
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:41268211"
variation 295
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:373878223"
CDS 298..924
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/note="Fas-associating protein with death domain;
Fas-associating death domain-containing protein; mediator
of receptor-induced toxicity; growth-inhibiting gene 3
protein; mediator of receptor induced toxicity"
/codon_start=1
/product="protein FADD"
/protein_id="NP_003815.1"
/db_xref="GI:4505229"
/db_xref="CCDS:CCDS8196.1"
/db_xref="GeneID:8772"
/db_xref="HGNC:3573"
/db_xref="HPRD:03909"
/db_xref="MIM:602457"
/translation="
MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS
"
misc_feature <376..>477
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/note="Death Effector Domain found in Fas-Associated via
Death Domain; Region: DED_FADD; cd08336"
/db_xref="CDD:176747"
misc_feature 586..843
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/note="Fas-associated Death Domain protein-protein
interaction domain; Region: Death_FADD; cd08306"
/db_xref="CDD:176722"
misc_feature order(592..594,601..606,613..618,700..705,709..711,
721..723,766..774,811..816,820..825,829..843)
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/note="FADD-FAS heterodimer interface [polypeptide
binding]; other site"
/db_xref="CDD:176722"
misc_feature order(793..795,820..822,829..834)
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/note="tetramer interface [polypeptide binding]; other
site"
/db_xref="CDD:176722"
misc_feature 877..879
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q13158.1); phosphorylation site"
misc_feature 877..879
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:05111"
misc_feature 877..879
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:02739"
misc_feature 877..879
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
variation 306
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="g"
/replace="t"
/db_xref="dbSNP:201376917"
variation 327
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="g"
/replace="t"
/db_xref="dbSNP:376395925"
variation 338
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:144264027"
variation 386
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="g"
/db_xref="dbSNP:369187743"
variation 390
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="g"
/replace="t"
/db_xref="dbSNP:41268213"
variation 426
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="c"
/db_xref="dbSNP:199774555"
variation 429
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:372468641"
variation 450
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="g"
/db_xref="dbSNP:150991874"
variation 481
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:376982543"
exon 584..1853
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/inference="alignment:Splign:1.39.8"
variation 604
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:200845739"
variation 610
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:369869993"
variation 612
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="g"
/replace="t"
/db_xref="dbSNP:387906839"
variation 621
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:41269121"
variation 643
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:374231786"
variation 675
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:61757382"
variation 676
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:376479518"
variation 681
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:369418021"
variation 696
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:2230821"
variation 710
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:61753267"
variation 718
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:201640221"
variation 736
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:140822085"
variation 749
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:150178083"
variation 761
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:373387225"
variation 773
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:200202420"
variation 775
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:376340895"
variation 848
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:145623767"
variation 880
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="g"
/db_xref="dbSNP:199518772"
variation 913
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:61740746"
variation 917
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:146934620"
variation 931
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:200489076"
variation 941
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:372852091"
variation 1143
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:370932710"
variation 1256
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="c"
/db_xref="dbSNP:376308879"
variation 1264
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:190902808"
variation 1299
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:180955808"
variation 1335
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:368539929"
variation 1336
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:61740747"
variation 1403
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:190056190"
variation 1445
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:41269123"
variation 1462
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="g"
/db_xref="dbSNP:41269125"
variation 1468..1469
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace=""
/replace="aca"
/db_xref="dbSNP:4197"
variation 1469..1470
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace=""
/replace="tgt"
/db_xref="dbSNP:368193213"
variation 1470..1471
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace=""
/replace="ttg"
/db_xref="dbSNP:45542838"
variation 1472..1473
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace=""
/replace="tgt"
/db_xref="dbSNP:71675294"
variation 1472
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="g"
/replace="t"
/db_xref="dbSNP:78879392"
variation 1480
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:1051422"
variation 1512..1513
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace=""
/replace="gg"
/db_xref="dbSNP:71681772"
variation 1519
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:138762178"
variation 1569
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:149373917"
variation 1613
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:374051992"
variation 1623
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:112972843"
variation 1666
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:144756684"
variation 1693
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="g"
/db_xref="dbSNP:111538026"
variation 1737
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:372590819"
variation 1762
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:182686322"
variation 1763
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="a"
/replace="g"
/db_xref="dbSNP:148502120"
polyA_signal 1804..1809
/gene="FADD"
/gene_synonym="GIG3; MORT1"
polyA_site 1829
/gene="FADD"
/gene_synonym="GIG3; MORT1"
variation 1832
/gene="FADD"
/gene_synonym="GIG3; MORT1"
/replace="c"
/replace="t"
/db_xref="dbSNP:1131715"
polyA_site 1834
/gene="FADD"
/gene_synonym="GIG3; MORT1"
polyA_site 1841
/gene="FADD"
/gene_synonym="GIG3; MORT1"
polyA_site 1853
/gene="FADD"
/gene_synonym="GIG3; MORT1"
ORIGIN
gacgatacgccgggcgcaggcgcagaagccgcgcccgtccgcggcgccgccagccagggcggaaacggctgcggcttcgctagggacgcatgcgcgggtcccttagttttcgcgagataacggtcgaaaacgcgctcttgtcgatttcctgtagtgaatcaggcaccggagtgcaggttcgggggtggaatccttgggccgctgggcaagcggcgagacctggccagggccagcgagccgaggacagagggcgcacggagggccgggccgcagccccggccgcttgcagaccccgccatggacccgttcctggtgctgctgcactcggtgtcgtccagcctgtcgagcagcgagctgaccgagctcaagttcctatgcctcgggcgcgtgggcaagcgcaagctggagcgcgtgcagagcggcctagacctcttctccatgctgctggagcagaacgacctggagcccgggcacaccgagctcctgcgcgagctgctcgcctccctgcggcgccacgacctgctgcggcgcgtcgacgacttcgaggcgggggcggcggccggggccgcgcctggggaagaagacctgtgtgcagcatttaacgtcatatgtgataatgtggggaaagattggagaaggctggctcgtcagctcaaagtctcagacaccaagatcgacagcatcgaggacagatacccccgcaacctgacagagcgtgtgcgggagtcactgagaatctggaagaacacagagaaggagaacgcaacagtggcccacctggtgggggctctcaggtcctgccagatgaacctggtggctgacctggtacaagaggttcagcaggcccgtgacctccagaacaggagtggggccatgtccccgatgtcatggaactcagacgcatctacctccgaagcgtcctgatgggccgctgctttgcgctggtggaccacaggcatctacacagcctggactttggttctctccaggaaggtagcccagcactgtgaagacccagcaggaagccaggctgagtgagccacagaccacctgcttctgaactcaagctgcgtttattaatgcctctcccgcaccaggccgggcttgggccctgcacagatatttccatttcttcctcactatgacactgagcaagatcttgtctccactaaatgagctcctgcgggagtagttggaaagttggaaccgtgtccagcacagaaggaatctgtgcagatgagcagtcacactgttactccacagcggaggagaccagctcagaggcccaggaatcggagcgaagcagagaggtggagaactgggatttgaacccccgccatccttcaccagagcccatgctcaaccactgtggcgttctgctgcccctgcagttggcagaaaggatgttttgtcccatttccttggaggccaccgggacagacctggacactagggtcaggcggggtgctgtggtggggagaggcatggctggggtgggggtggggagacctggttggccgtggtccagctcttggcccctgtgtgagttgagtctcctctctgagactgctaagtaggggcagtgatggttgccaggacgaattgagataatatctgtgaggtgctgatgagtgattgacacacagcactctctaaatcttccttgtgaggattatgggtcctgcaattctacagtttcttactgttttgtatcaaaatcactatctttctgataacagaattgccaaggcagcgggatctcgtatctttaaaaagcagtcctcttattcctaaggtaatcctattaaaacacagctttacaacttccatactacaaaaaattttctattcctaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:8772 -> Molecular function: GO:0002020 [protease binding] evidence: IPI
GeneID:8772 -> Molecular function: GO:0005123 [death receptor binding] evidence: TAS
GeneID:8772 -> Molecular function: GO:0005164 [tumor necrosis factor receptor binding] evidence: IEA
GeneID:8772 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:8772 -> Molecular function: GO:0032813 [tumor necrosis factor receptor superfamily binding] evidence: IPI
GeneID:8772 -> Molecular function: GO:0042802 [identical protein binding] evidence: IPI
GeneID:8772 -> Biological process: GO:0002224 [toll-like receptor signaling pathway] evidence: TAS
GeneID:8772 -> Biological process: GO:0002756 [MyD88-independent toll-like receptor signaling pathway] evidence: TAS
GeneID:8772 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:8772 -> Biological process: GO:0006919 [activation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: TAS
GeneID:8772 -> Biological process: GO:0008625 [extrinsic apoptotic signaling pathway via death domain receptors] evidence: TAS
GeneID:8772 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
GeneID:8772 -> Biological process: GO:0032757 [positive regulation of interleukin-8 production] evidence: IDA
GeneID:8772 -> Biological process: GO:0032760 [positive regulation of tumor necrosis factor production] evidence: IDA
GeneID:8772 -> Biological process: GO:0034138 [toll-like receptor 3 signaling pathway] evidence: TAS
GeneID:8772 -> Biological process: GO:0034142 [toll-like receptor 4 signaling pathway] evidence: TAS
GeneID:8772 -> Biological process: GO:0035666 [TRIF-dependent toll-like receptor signaling pathway] evidence: TAS
GeneID:8772 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IMP
GeneID:8772 -> Biological process: GO:0043123 [positive regulation of I-kappaB kinase/NF-kappaB cascade] evidence: IEP
GeneID:8772 -> Biological process: GO:0045087 [innate immune response] evidence: TAS
GeneID:8772 -> Biological process: GO:0045862 [positive regulation of proteolysis] evidence: IDA
GeneID:8772 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IDA
GeneID:8772 -> Biological process: GO:0051291 [protein heterooligomerization] evidence: IEA
GeneID:8772 -> Biological process: GO:0051607 [defense response to virus] evidence: IMP
GeneID:8772 -> Biological process: GO:0060340 [positive regulation of type I interferon-mediated signaling pathway] evidence: IMP
GeneID:8772 -> Biological process: GO:0070265 [necrotic cell death] evidence: IMP
GeneID:8772 -> Biological process: GO:0071260 [cellular response to mechanical stimulus] evidence: IEP
GeneID:8772 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: IDA
GeneID:8772 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: TAS
GeneID:8772 -> Biological process: GO:0097191 [extrinsic apoptotic signaling pathway] evidence: IDA
GeneID:8772 -> Biological process: GO:0097191 [extrinsic apoptotic signaling pathway] evidence: IMP
GeneID:8772 -> Biological process: GO:0097191 [extrinsic apoptotic signaling pathway] evidence: TAS
GeneID:8772 -> Biological process: GO:0097202 [activation of cysteine-type endopeptidase activity] evidence: IDA
GeneID:8772 -> Biological process: GO:2001238 [positive regulation of extrinsic apoptotic signaling pathway] evidence: IMP
GeneID:8772 -> Biological process: GO:2001239 [regulation of extrinsic apoptotic signaling pathway in absence of ligand] evidence: TAS
GeneID:8772 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:8772 -> Cellular component: GO:0031264 [death-inducing signaling complex] evidence: IDA
GeneID:8772 -> Cellular component: GO:0031265 [CD95 death-inducing signaling complex] evidence: IDA
GeneID:8772 -> Cellular component: GO:0043005 [neuron projection] evidence: IEA
GeneID:8772 -> Cellular component: GO:0044297 [cell body] evidence: IEA
GeneID:8772 -> Cellular component: GO:0045121 [membrane raft] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.