GGRNA Home | Help | Advanced search

2019-03-24 20:36:29, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_003818               9323 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens CDP-diacylglycerol synthase (phosphatidate
            cytidylyltransferase) 2 (CDS2), mRNA.
ACCESSION   NM_003818
VERSION     NM_003818.3  GI:334085265
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 9323)
  AUTHORS   Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V.,
            Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
  CONSRTM   DREAM investigators
  TITLE     Variation at the NFATC2 locus increases the risk of
            thiazolidinedione-induced edema in the Diabetes REduction
            Assessment with ramipril and rosiglitazone Medication (DREAM) study
  JOURNAL   Diabetes Care 33 (10), 2250-2253 (2010)
   PUBMED   20628086
  REMARK    GeneRIF: Observational study of gene-disease association,
            gene-environment interaction, and pharmacogenomic / toxicogenomic.
            (HuGE Navigator)
REFERENCE   2  (bases 1 to 9323)
  AUTHORS   Talmud,P.J., Drenos,F., Shah,S., Shah,T., Palmen,J., Verzilli,C.,
            Gaunt,T.R., Pallas,J., Lovering,R., Li,K., Casas,J.P., Sofat,R.,
            Kumari,M., Rodriguez,S., Johnson,T., Newhouse,S.J., Dominiczak,A.,
            Samani,N.J., Caulfield,M., Sever,P., Stanton,A., Shields,D.C.,
            Padmanabhan,S., Melander,O., Hastie,C., Delles,C., Ebrahim,S.,
            Marmot,M.G., Smith,G.D., Lawlor,D.A., Munroe,P.B., Day,I.N.,
            Kivimaki,M., Whittaker,J., Humphries,S.E. and Hingorani,A.D.
  CONSRTM   ASCOT investigators; NORDIL investigators; BRIGHT Consortium
  TITLE     Gene-centric association signals for lipids and apolipoproteins
            identified via the HumanCVD BeadChip
  JOURNAL   Am. J. Hum. Genet. 85 (5), 628-642 (2009)
   PUBMED   19913121
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   3  (bases 1 to 9323)
  AUTHORS   Halford,S., Inglis,S., Gwilliam,R., Spencer,P., Mohamed,M.,
            Ebenezer,N.D. and Hunt,D.M.
  TITLE     Genomic organization of human CDS2 and evaluation as a candidate
            gene for corneal hereditary endothelial dystrophy 2 on chromosome
            20p13
  JOURNAL   Exp. Eye Res. 75 (5), 619-623 (2002)
   PUBMED   12457874
REFERENCE   4  (bases 1 to 9323)
  AUTHORS   Deloukas,P., Matthews,L.H., Ashurst,J., Burton,J., Gilbert,J.G.,
            Jones,M., Stavrides,G., Almeida,J.P., Babbage,A.K., Bagguley,C.L.,
            Bailey,J., Barlow,K.F., Bates,K.N., Beard,L.M., Beare,D.M.,
            Beasley,O.P., Bird,C.P., Blakey,S.E., Bridgeman,A.M., Brown,A.J.,
            Buck,D., Burrill,W., Butler,A.P., Carder,C., Carter,N.P.,
            Chapman,J.C., Clamp,M., Clark,G., Clark,L.N., Clark,S.Y.,
            Clee,C.M., Clegg,S., Cobley,V.E., Collier,R.E., Connor,R.,
            Corby,N.R., Coulson,A., Coville,G.J., Deadman,R., Dhami,P.,
            Dunn,M., Ellington,A.G., Frankland,J.A., Fraser,A., French,L.,
            Garner,P., Grafham,D.V., Griffiths,C., Griffiths,M.N., Gwilliam,R.,
            Hall,R.E., Hammond,S., Harley,J.L., Heath,P.D., Ho,S., Holden,J.L.,
            Howden,P.J., Huckle,E., Hunt,A.R., Hunt,S.E., Jekosch,K.,
            Johnson,C.M., Johnson,D., Kay,M.P., Kimberley,A.M., King,A.,
            Knights,A., Laird,G.K., Lawlor,S., Lehvaslaiho,M.H., Leversha,M.,
            Lloyd,C., Lloyd,D.M., Lovell,J.D., Marsh,V.L., Martin,S.L.,
            McConnachie,L.J., McLay,K., McMurray,A.A., Milne,S., Mistry,D.,
            Moore,M.J., Mullikin,J.C., Nickerson,T., Oliver,K., Parker,A.,
            Patel,R., Pearce,T.A., Peck,A.I., Phillimore,B.J.,
            Prathalingam,S.R., Plumb,R.W., Ramsay,H., Rice,C.M., Ross,M.T.,
            Scott,C.E., Sehra,H.K., Shownkeen,R., Sims,S., Skuce,C.D.,
            Smith,M.L., Soderlund,C., Steward,C.A., Sulston,J.E., Swann,M.,
            Sycamore,N., Taylor,R., Tee,L., Thomas,D.W., Thorpe,A., Tracey,A.,
            Tromans,A.C., Vaudin,M., Wall,M., Wallis,J.M., Whitehead,S.L.,
            Whittaker,P., Willey,D.L., Williams,L., Williams,S.A., Wilming,L.,
            Wray,P.W., Hubbard,T., Durbin,R.M., Bentley,D.R., Beck,S. and
            Rogers,J.
  TITLE     The DNA sequence and comparative analysis of human chromosome 20
  JOURNAL   Nature 414 (6866), 865-871 (2001)
   PUBMED   11780052
REFERENCE   5  (bases 1 to 9323)
  AUTHORS   Volta,M., Bulfone,A., Gattuso,C., Rossi,E., Mariani,M.,
            Consalez,G.G., Zuffardi,O., Ballabio,A., Banfi,S. and Franco,B.
  TITLE     Identification and characterization of CDS2, a mammalian homolog of
            the Drosophila CDP-diacylglycerol synthase gene
  JOURNAL   Genomics 55 (1), 68-77 (1999)
   PUBMED   9889000
REFERENCE   6  (bases 1 to 9323)
  AUTHORS   Halford,S., Dulai,K.S., Daw,S.C., Fitzgibbon,J. and Hunt,D.M.
  TITLE     Isolation and chromosomal localization of two human
            CDP-diacylglycerol synthase (CDS) genes
  JOURNAL   Genomics 54 (1), 140-144 (1998)
   PUBMED   9806839
REFERENCE   7  (bases 1 to 9323)
  AUTHORS   Lykidis,A., Jackson,P.D., Rock,C.O. and Jackowski,S.
  TITLE     The role of CDP-diacylglycerol synthetase and phosphatidylinositol
            synthase activity levels in the regulation of cellular
            phosphatidylinositol content
  JOURNAL   J. Biol. Chem. 272 (52), 33402-33409 (1997)
   PUBMED   9407135
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BP353230.1, AK315489.1 and
            AL121755.23.
            On May 26, 2011 this sequence version replaced gi:22035625.
            
            Summary: Breakdown products of phosphoinositides are ubiquitous
            second messengers that function downstream of many G
            protein-coupled receptors and tyrosine kinases regulating cell
            growth, calcium metabolism, and protein kinase C activity. This
            gene encodes an enzyme which regulates the amount of
            phosphatidylinositol available for signaling by catalyzing the
            conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme
            is an integral membrane protein localized to two subcellular
            domains, the matrix side of the inner mitochondrial membrane where
            it is thought to be involved in the synthesis of
            phosphatidylglycerol and cardiolipin and the cytoplasmic side of
            the endoplasmic reticulum where it functions in
            phosphatidylinositol biosynthesis. Two genes encoding this enzyme
            have been identified in humans, one mapping to human chromosome
            4q21 and a second to 20p13. [provided by RefSeq, Jul 2008].
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: Y16521.1, AK027695.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-19                BP353230.1         1-19
            20-1670             AK315489.1         1-1651
            1671-9323           AL121755.23        17645-25297
FEATURES             Location/Qualifiers
     source          1..9323
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="20"
                     /map="20p13"
     gene            1..9323
                     /gene="CDS2"
                     /note="CDP-diacylglycerol synthase (phosphatidate
                     cytidylyltransferase) 2"
                     /db_xref="GeneID:8760"
                     /db_xref="HGNC:1801"
                     /db_xref="HPRD:09150"
                     /db_xref="MIM:603549"
     exon            1..389
                     /gene="CDS2"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    189..191
                     /gene="CDS2"
                     /note="upstream in-frame stop codon"
     variation       226..227
                     /gene="CDS2"
                     /replace=""
                     /replace="gggcg"
                     /db_xref="dbSNP:11466986"
     variation       227..228
                     /gene="CDS2"
                     /replace=""
                     /replace="gggcg"
                     /db_xref="dbSNP:34266571"
     variation       231..232
                     /gene="CDS2"
                     /replace=""
                     /replace="ggggc"
                     /db_xref="dbSNP:71944688"
     variation       235..236
                     /gene="CDS2"
                     /replace=""
                     /replace="cgggg"
                     /db_xref="dbSNP:72270942"
     variation       238..239
                     /gene="CDS2"
                     /replace=""
                     /replace="ggcgg"
                     /db_xref="dbSNP:67020207"
     variation       240..241
                     /gene="CDS2"
                     /replace=""
                     /replace="ggggc"
                     /db_xref="dbSNP:59606548"
     variation       283
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113493863"
     CDS             333..1670
                     /gene="CDS2"
                     /EC_number="2.7.7.41"
                     /note="CDP-diglyceride synthetase 2; CDP-diglyceride
                     pyrophosphorylase 2; CDP-diglyceride diphosphorylase 2;
                     CDP-DAG synthase 2; CDP-DG synthetase 2; CTP:phosphatidate
                     cytidylyltransferase 2; CDP-diacylglycerol synthase 2; CDS
                     2; CDP-DG synthase 2; CDP-diglyceride synthase 2"
                     /codon_start=1
                     /product="phosphatidate cytidylyltransferase 2"
                     /protein_id="NP_003809.1"
                     /db_xref="GI:20143480"
                     /db_xref="CCDS:CCDS13088.1"
                     /db_xref="GeneID:8760"
                     /db_xref="HGNC:1801"
                     /db_xref="HPRD:09150"
                     /db_xref="MIM:603549"
                     /translation="
MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLRSHLIDKGMLTSTTEDE
"
     misc_feature    393..395
                     /gene="CDS2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (O95674.1); phosphorylation site"
     misc_feature    393..395
                     /gene="CDS2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    429..431
                     /gene="CDS2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (O95674.1); phosphorylation site"
     misc_feature    435..437
                     /gene="CDS2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (O95674.1); phosphorylation site"
     misc_feature    441..443
                     /gene="CDS2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (O95674.1); phosphorylation site"
     misc_feature    567..629
                     /gene="CDS2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95674.1);
                     transmembrane region"
     misc_feature    648..1607
                     /gene="CDS2"
                     /note="Cytidylyltransferase family; Region: CTP_transf_1;
                     cl00347"
                     /db_xref="CDD:185926"
     misc_feature    726..788
                     /gene="CDS2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95674.1);
                     transmembrane region"
     misc_feature    828..890
                     /gene="CDS2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95674.1);
                     transmembrane region"
     misc_feature    969..1031
                     /gene="CDS2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95674.1);
                     transmembrane region"
     misc_feature    1116..1178
                     /gene="CDS2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95674.1);
                     transmembrane region"
     misc_feature    1350..1412
                     /gene="CDS2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95674.1);
                     transmembrane region"
     exon            390..526
                     /gene="CDS2"
                     /inference="alignment:Splign:1.39.8"
     variation       407
                     /gene="CDS2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:5013472"
     variation       441
                     /gene="CDS2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:373151186"
     variation       455
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372748731"
     variation       456
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150527816"
     variation       458
                     /gene="CDS2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:138251157"
     variation       526
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375638808"
     exon            527..623
                     /gene="CDS2"
                     /inference="alignment:Splign:1.39.8"
     variation       567
                     /gene="CDS2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:35315800"
     variation       623
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140103955"
     exon            624..721
                     /gene="CDS2"
                     /inference="alignment:Splign:1.39.8"
     variation       627
                     /gene="CDS2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:118058125"
     variation       633
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370528801"
     variation       713
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145582118"
     exon            722..861
                     /gene="CDS2"
                     /inference="alignment:Splign:1.39.8"
     variation       755
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375500781"
     variation       776
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200304958"
     variation       785
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368516080"
     exon            862..920
                     /gene="CDS2"
                     /inference="alignment:Splign:1.39.8"
     variation       878
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35796695"
     variation       903
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201613534"
     exon            921..1003
                     /gene="CDS2"
                     /inference="alignment:Splign:1.39.8"
     variation       951
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149850561"
     exon            1004..1091
                     /gene="CDS2"
                     /inference="alignment:Splign:1.39.8"
     variation       1007
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200494742"
     variation       1020
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112055575"
     variation       1025
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201506899"
     variation       1061
                     /gene="CDS2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:149118554"
     variation       1075
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143175887"
     variation       1079
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368700421"
     exon            1092..1160
                     /gene="CDS2"
                     /inference="alignment:Splign:1.39.8"
     variation       1097
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148918269"
     variation       1106
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3818196"
     variation       1147
                     /gene="CDS2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:372946609"
     exon            1161..1313
                     /gene="CDS2"
                     /inference="alignment:Splign:1.39.8"
     variation       1178
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111727857"
     variation       1263
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146586086"
     variation       1285..1286
                     /gene="CDS2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:34055146"
     variation       1312
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141290228"
     exon            1314..1433
                     /gene="CDS2"
                     /inference="alignment:Splign:1.39.8"
     variation       1318
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144822618"
     variation       1320
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138666853"
     variation       1322
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372404549"
     variation       1323
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376439839"
     variation       1331
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370998735"
     variation       1352
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150695888"
     variation       1400
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34096549"
     exon            1434..1537
                     /gene="CDS2"
                     /inference="alignment:Splign:1.39.8"
     variation       1448
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201496221"
     exon            1538..9323
                     /gene="CDS2"
                     /inference="alignment:Splign:1.39.8"
     variation       1582
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:137924546"
     variation       1598
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370172531"
     variation       1616
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149449414"
     variation       1618
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143859713"
     variation       1620
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200238442"
     variation       1631
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138757559"
     variation       1634
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373419561"
     variation       1664
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147360412"
     variation       1673
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370840326"
     variation       1675
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373995252"
     variation       1696
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202125562"
     variation       1698
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377586394"
     variation       1701
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370518772"
     variation       1719
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201416938"
     variation       1777
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:79005883"
     variation       1782
                     /gene="CDS2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:11477708"
     variation       1795
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:77534359"
     variation       1856..1857
                     /gene="CDS2"
                     /replace=""
                     /replace="tg"
                     /db_xref="dbSNP:148444736"
     variation       1857..1858
                     /gene="CDS2"
                     /replace=""
                     /replace="gt"
                     /db_xref="dbSNP:376747167"
     polyA_site      1893
                     /gene="CDS2"
     STS             1938..2815
                     /gene="CDS2"
                     /standard_name="CDS2_8852"
                     /db_xref="UniSTS:467598"
     variation       1955
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3746676"
     variation       1970
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370213630"
     variation       2009
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373120596"
     variation       2012
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372714470"
     variation       2255
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:16990718"
     variation       2314
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192605496"
     variation       2319
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377160221"
     variation       2333
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139435606"
     variation       2416
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370375427"
     variation       2458
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185604094"
     variation       2496
                     /gene="CDS2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:145170759"
     variation       2572
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:73586501"
     STS             2600..2700
                     /gene="CDS2"
                     /standard_name="RH18488"
                     /db_xref="UniSTS:40994"
     polyA_site      2613
                     /gene="CDS2"
     variation       2645
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143949213"
     STS             2655..2743
                     /gene="CDS2"
                     /standard_name="RH28677"
                     /db_xref="UniSTS:86274"
     variation       2724
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148664719"
     polyA_signal    2756..2761
                     /gene="CDS2"
     variation       2772
                     /gene="CDS2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:112348943"
     variation       2776
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113927874"
     polyA_site      2779
                     /gene="CDS2"
     variation       2803
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6116683"
     variation       2811
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192957660"
     variation       2824
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3746677"
     variation       2851
                     /gene="CDS2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:368483864"
     variation       2858..2859
                     /gene="CDS2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:3833325"
     variation       2902
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151226067"
     variation       2950
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:376154035"
     variation       2970
                     /gene="CDS2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:184515327"
     variation       2973
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188840903"
     variation       3025
                     /gene="CDS2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:77805175"
     variation       3034
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:181309279"
     variation       3072
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6116684"
     variation       3088
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374504723"
     variation       3098
                     /gene="CDS2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:113805579"
     variation       3194
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6085025"
     variation       3212
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140379455"
     variation       3228..3229
                     /gene="CDS2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:35911658"
     variation       3260
                     /gene="CDS2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:16990725"
     variation       3262
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368055426"
     variation       3282
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:144141819"
     variation       3290
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146799297"
     variation       3359
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:117556296"
     variation       3501
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183986023"
     variation       3519
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140508849"
     variation       3541
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2295510"
     variation       3632
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150430322"
     variation       3637
                     /gene="CDS2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:189261022"
     variation       3739
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:34915502"
     variation       3786
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149196199"
     variation       3796..3797
                     /gene="CDS2"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:201362541"
     variation       3797..3798
                     /gene="CDS2"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:72474918"
     variation       3798..3804
                     /gene="CDS2"
                     /replace="cggggtc"
                     /replace="gggggtca"
                     /db_xref="dbSNP:71339308"
     variation       3798
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:6133193"
     variation       3802
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:77407209"
     variation       3803
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:75789066"
     variation       3804..3805
                     /gene="CDS2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:11376563"
     variation       3804
                     /gene="CDS2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:79995762"
     variation       3805..3806
                     /gene="CDS2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:71658859"
     variation       3825
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:180751229"
     variation       3856
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:78604961"
     variation       3978
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143328476"
     variation       4003
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114773445"
     variation       4011
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187362634"
     variation       4024
                     /gene="CDS2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:148345903"
     variation       4060
                     /gene="CDS2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:71785622"
     variation       4061..4062
                     /gene="CDS2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:71696033"
     polyA_signal    4079..4084
                     /gene="CDS2"
     polyA_site      4101
                     /gene="CDS2"
     variation       4168
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2295511"
     variation       4262
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17785402"
     variation       4263
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112593797"
     variation       4396
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192206395"
     variation       4400
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:115679878"
     variation       4413
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147533038"
     variation       4427
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:117040381"
     variation       4457
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181714474"
     variation       4599
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185897318"
     variation       4606
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371569910"
     variation       4773
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:137952466"
     variation       4783
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:118074285"
     variation       4811
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:190308096"
     variation       4820
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143368283"
     variation       4829
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6053188"
     variation       4832
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182595893"
     variation       5019
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73588505"
     variation       5056
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372776920"
     variation       5072
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150538331"
     variation       5079
                     /gene="CDS2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:372483093"
     variation       5187
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139496708"
     variation       5190
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:377233101"
     variation       5206
                     /gene="CDS2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374812206"
     variation       5213
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4815770"
     variation       5214
                     /gene="CDS2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:149724972"
     variation       5255
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186870509"
     variation       5357
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190916180"
     variation       5365
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:182741081"
     variation       5389
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144562972"
     variation       5390
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6038088"
     variation       5411
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:188957351"
     variation       5553..5554
                     /gene="CDS2"
                     /replace=""
                     /replace="cct"
                     /db_xref="dbSNP:139019564"
     variation       5554..5555
                     /gene="CDS2"
                     /replace=""
                     /replace="cct"
                     /db_xref="dbSNP:377550963"
     variation       5589
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139296325"
     variation       5717
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:193242913"
     variation       5771
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:6116685"
     variation       5837
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184760821"
     variation       5845
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:73893915"
     variation       5865
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:187528369"
     variation       5966
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114672710"
     variation       6027
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:732817"
     variation       6072
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:78660111"
     variation       6073
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:79181201"
     variation       6092
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146502839"
     variation       6105
                     /gene="CDS2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:114650868"
     variation       6163
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:192047611"
     variation       6246
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:79341417"
     variation       6272
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184235050"
     variation       6282
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189795796"
     variation       6299
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140522342"
     variation       6333
                     /gene="CDS2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:6085026"
     variation       6344
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:180993113"
     variation       6409
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142763591"
     variation       6464
                     /gene="CDS2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:184471908"
     variation       6551
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151069492"
     variation       6580
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115832519"
     variation       6594
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111535554"
     variation       6680
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141007361"
     variation       6748..6750
                     /gene="CDS2"
                     /replace=""
                     /replace="cct"
                     /db_xref="dbSNP:138570405"
     variation       6784
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150215830"
     variation       6841
                     /gene="CDS2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:147940319"
     variation       6917
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113318278"
     variation       6939
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190555979"
     variation       6999
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:62200450"
     variation       7014
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200274819"
     variation       7024
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111861880"
     variation       7070..7071
                     /gene="CDS2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:34130515"
     variation       7193
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147114585"
     variation       7229
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181883591"
     variation       7230
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186138421"
     variation       7268
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:8184346"
     variation       7334
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369214363"
     variation       7383
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138514359"
     variation       7403
                     /gene="CDS2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:190550970"
     variation       7412
                     /gene="CDS2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:143434074"
     variation       7416
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12624765"
     variation       7457
                     /gene="CDS2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:6107592"
     variation       7563
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:181476298"
     variation       7626
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143012076"
     variation       7640
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73588512"
     variation       7690
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114347250"
     variation       7706
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148187692"
     variation       7722
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370686814"
     variation       7732
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186478894"
     variation       7738
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191407200"
     variation       7805
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76937866"
     variation       7872
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182723727"
     variation       7902
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187908021"
     variation       7913
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374430411"
     variation       8042
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:116811504"
     variation       8123
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190603181"
     variation       8131
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112972504"
     variation       8229
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112568411"
     variation       8283
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:77435581"
     variation       8436
                     /gene="CDS2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:187759246"
     variation       8462
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141226154"
     variation       8465
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17179149"
     variation       8571
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150744336"
     variation       8653
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:73588514"
     variation       8670..8673
                     /gene="CDS2"
                     /replace=""
                     /replace="tttt"
                     /db_xref="dbSNP:369358087"
     variation       8670
                     /gene="CDS2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:11479516"
     variation       8683..8685
                     /gene="CDS2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:375764367"
     variation       8683
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370640072"
     variation       8685
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:58233176"
     variation       8685
                     /gene="CDS2"
                     /replace=""
                     /replace="t"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:71197755"
     variation       8686..8687
                     /gene="CDS2"
                     /replace=""
                     /replace="gg"
                     /db_xref="dbSNP:372486768"
     variation       8687
                     /gene="CDS2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:60990164"
     variation       8700..8701
                     /gene="CDS2"
                     /replace=""
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:62859362"
     variation       8826
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192303776"
     variation       8869..8871
                     /gene="CDS2"
                     /replace=""
                     /replace="cc"
                     /db_xref="dbSNP:200774815"
     variation       8870..8871
                     /gene="CDS2"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:139068511"
     variation       8872..8873
                     /gene="CDS2"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:71791375"
     variation       9023
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182967855"
     variation       9040
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:62200451"
     variation       9145
                     /gene="CDS2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375537545"
     variation       9146
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188170671"
     variation       9185
                     /gene="CDS2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139309460"
     variation       9259
                     /gene="CDS2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:142519884"
     polyA_signal    9302..9307
                     /gene="CDS2"
     variation       9320
                     /gene="CDS2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:3746678"
     variation       9321
                     /gene="CDS2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:146035656"
     polyA_site      9323
                     /gene="CDS2"
ORIGIN      
atttgcgccattggtggatattccggaccgtgatggtggcgctgcgcgtgcgcactcgctccgagccctgctcccgggagagggagctctcgggtcggggctagggaaggctgaccccgctcggcccgggtgaaagggcggtgacggcactgggtggggccgagctccagggctggctgctgggctgctaagggaactgtgagccgctcagagccgcgcgcctcccgggcggggcggggccggccgtgggagtccgcgcgtgcccgcgccgagctgcctgctccggcggcttcgctgctagctcgcggcgacgtcgggccgattttcccaggatgacagagctgaggcagagggtggcccatgagccggttgcgccacccgaggacaaggagtcagagtcagaagcaaaggtagatggagagactgcatcggacagtgagagccgggcagaatccgcacccctgccagtctctgcagatgataccccggaggtcctcaatagggccctttccaacttgtcttcaagatggaagaactggtgggtgagaggcatcctgactttggccatgattgcatttttcttcatcatcatttacctgggaccaatggttttgatgataatcgtgatgtgcgttcagattaagtgtttccatgagataatcactattggctacaacgtctaccactcatatgatctgccctggttcaggacgctcagctggtactttctcctgtgtgtaaactatttcttctatggtgagacagtgacggattacttcttcaccctggtccagagagaagagcctttgcggattctcagtaaataccaccggttcatttcctttactctctatctaataggattctgcatgtttgtactgagtctggtcaagaagcattatcgactgcagttctacatgtttggctggacccatgtgacattgctgattgttgtaacacagtcacatcttgttatccacaacctatttgaaggaatgatctggttcattgtccccatatcttgtgtgatctgtaatgacatcatggcctatatgtttggctttttctttggtcggaccccactcatcaagctgtccccgaagaagacctgggaaggcttcattgggggcttctttgctactgtggtgtttggccttctgctgtcctatgtgatgtccgggtacagatgctttgtctgccctgtggagtacaacaatgacaccaacagcttcactgtggactgtgagccctcggacctgtttcgcctgcaggagtacaacattcctggggtgatccagtcagtcattggctggaaaacggtccggatgtaccccttccagattcacagcatcgctctctccacctttgcctcgctcattggcccctttggaggattcttcgcaagtggattcaaacgagcctttaaaatcaaagactttgccaataccattcctggccatggaggcatcatggatcgctttgactgccagtatctgatggccacctttgtcaatgtatacatcgccagttttatcagaggccctaacccaagcaaactgattcagcagttcctgactttacggccagatcagcagctccacatcttcaacacgctgcggtctcatctgatcgacaaagggatgctgacatccaccacagaggacgagtaggggccacccagggccaggagaacaggaacagaactgagcaggggcaggtctccaaggcaagcccagctggtgtgacttagacaatgacgaggcttcaactcactgtcttttttttttttttttggagggtattttttatttgtgggttcaaaaaatctgtatatacagtctatgtgtttagaatttgtgttgtaagtaaactacagctttgagttggaaagaagtcacgggttgtaaaaccatttggatttttttaaaacaaaagtattaataatctggaagacagtgttgcccaggtcaggagtgttttcttggtggttccagcccccatcaattgaactgtttctgggctcagtcagacacagacattcatctgtgtctgaccaaatcaggggacttccccacctgtggtgggaggcacagcttagatgttttgtacacctggtcttttctagaaatccctgcttggagctgcagaagggttgccttctgtaggtcggaggaatggaggcttactaaccaggtaagccttctatgcatccacaccaaaatcctgcagaatgtaagtaagctctgctttataagatgggttcaccttcatcgcagactgaaagtttcagtttttatttttttcagaaagcacgaaaaattatttataatagtctggagaaaaaacacactgtaatatttcaagtgtatgcagtagaatgtactgtaactgagccctttcccacatgtctaggctccaatgtctcctgtaggtccacctaactgtgtgttttcagggacaatgccatccatgtttgtgctgtagacttgctgctgctgaatcctttctggggactttctcatcgggcagggagcagagggcttctcgttcatgcaccctttgcctgaacacccatgtagctgctgtgttgtgtatatattactcttaagaggagtgtgtgtgtctgtgtttgttttaaaagtcacttatttcttacagtgatttcaattgcaccatgacttcttcactaaaaccacaaagtcctgcttaaaactatggaaaacctaacctgattagagccttgactattttgaagattaaatgcacactttttatataatgtgaccagtttaaatgtagtttgtattgtactgggggacctttcgttgttgttgtttgcttaaactgtgattttttttcccctccctaatttcaggggtgagattgactttgggaagacagattagttctttgtcaggccaacaagtgatggagtgcgggagagagaacttggcacccaaatatatcaaactattccgtgccgtggatgttttcattgccaacgagggtgtaatgatttgcttctgcaccttggtctagtgctggtttgtggtgtttttgtttgtaaattagcctcactgcctccctgaaagtgcacagtcagcccaggtctctagagtgtccagcagaggatggagccctcgggatgtttcagctcacacatccttgagtgacttcccatatgtgtgtggggctgaagcggcttctttccgctgaacttttatttccatttcagcctcgtggcttctcttattcaggtccaaggccccttaaaaacaaaacatattatcgcaagggctttcatttcagtattggctgtgtcactggcaggatgcatcactctccagggcctctttttcggagctactcccaattccactcttctgtgattctggctgagcaagttcatgccggtagaggctcattaagtgaggtcctgggcaccccccaaacaggaagtgttttcaggcccttacatgcttatccttaaggtgagtaggtatctcagcagcacacccgaacagtaaaggtgatcaataacgaaactgtagttttcagattgaagaatgaacctggatcaccaaactagataccgaaagggctcctcatttgtctcttttgtcccattgtgggcatatggtgggctccttgagaggagggagtctcagctggggcctggctgcagagacctgctcttgaatagggctgcctttgggatcagggagccgagcatactgggcaaggctcatcatgttcctttgtggaagtggttacttggtgggggtggggtggggaaggggggtctaggaagccgaagctgagtgcgcactagagctgctagcaggcaggccagagggtcagcttgtgttttattttctgatttctcctgcatgctttctggagatgaggattttttgtcaggtagctaggagagcactgccaccttgtgtccatatagcacaatgtttctctttcctattcacagacaagattcaagaaaccatttttacgtgtgtacattcaaatcttcatgaatggcatcacttgctttagacccattttttttttattggtcagaaataaaatgtgactgcaactgtgtgccctcccttgtcgtgaattccctgtttatcacttccatgcatggttttatgcttctcatttgtttatgtattcatgaatactgcatagtcctgattcagagacttttgctttgctttccaacttgtatccctacattctcacaacagccttcttacctcgggtgagagtcatgagcaccttaccaggcagggagcttccccaggatagtgtggtggagtcaggactcactccatcctgcactttacccacaggacacctggagggtcccccagccctgcttgcttttgtgaacgtcgtgtgagtacaccgaggtgttgcagctttccttccctctagctcaggaggcctggcctgagccaggttggagcttaaattgctgttggctcctgcctggtggaacaagggggtcatagaaaccagggctgatgggcaccccccagcccctgggagctctgctcatgaccgctcacagggtaccgagtctttgccttttgtgtgtgcgcatgctgccctcttaactgcttttagtattcagaaaggttccatttatgttttactcctgaaagtgaaaccctcttaggcaacttgtttcatattctgggcattttagtagctacagtattttgcatttaaaatgtaattactcttagtattgtacagccctataatgtatgagaactagtttcacatcctttgaaactaatctctttcattggggaggatacaacttttgactttacacaggtggactttgaatccatttttatagaatttttttccactgtaacttgacctatattatgcaagaaaatcccaaaaatatgttttaagggagactacacagaccttgtgatttggtctgagctagttgctgagttgactggagccttatttgaatggatctttgagttgagatcttcacactgtcagtgagcccttggctcagcccttgtcacctgtttgtatggggaccatgtttcccaaagctcaggttcatctccactattgacagagtcgggtagtgggagagtataagtgacttgagacagagtgtccttgctcagaaaactgtgaagcaggggtcttgttagttacaaagccagtcctagttgcatgtccaagggggtagattttcatcaccctactaaatgtggtatgtcactgctgaagccttttcctgttttagtaatatcttaggcactattgtcttttgtcttccagagtaacatatctgggcccacctttcttgcacactgtgattatgtgctaagaaaagggtggagttgggaggacaatttcacttgaacaggtttctgttcttctgaggtcagggtggggaggatgtccaggtgacttttatggacacattgcaagacagtaagccgcggatggactctcacttgtgctttggaacactggactccaaagagcaggtggaacaaactctggcctgaagatgatggctaatactcaggcagagccccgtattcttccctgacttggtcaaaacaaacttccttttcccttgatcaccctgcacgcagctgcccagcttccagtttttaaagagatgaacagctctcacttcctgactcagtttctcttgttgggtgggggccttgtgccacaacctgcatggggtgctagggtttaaaccaagtggtcacgaaggattcttatctcagggctctgcctggcccaccttctcttgggcctggactctccttatccacatccctgcagaaggtgggccctattctcagaagagtcctggctgctgttgccatctgaatgcgcccttccctttcaggttgaccagcagtggccttacctggcctctcaggtggatggaggctgttctcatctggggctgtctcttgattaaggctgtcacctgtttgtatagggaccatgtttcccaacgcactttgagtgcagtttaggaggtatcctttggatgctgaagtgttgggattttgaggacatgcggatgatttatgagaatagaggggcagagtttgtgaagtctagggttttttgtccagtgggtttcaaatttgttggctgtttaaagaccctgtctcctcccccaccctccccttccttttcccatcaaatgcctacctactgaggcgccttctctttttattcttgagccaatgagatatcagtgtgtttattaataaggattgcaatagtatagtgcttaatatgtgccaggcatagtgctaagggtttacatacgttatcccttttaatccagaaaacagcctttgattaggtattgttgtctccattttatagatgaggaaactgaggcagtatgactgaggccgagagcagtggttaagacagactttgggatcaaatcaccctaggtgcgggcaggtttctaggctgctctaagcttctaccttgaaggcagttgggtctgataatagtaccttcttcctggggtggttgtgaggatataacgaggtaatgcatgtaagcatttagtaccatgcctggcacatagtaagcactcaataaatggtagttacttttgttgagctcagctggtagtttgacctccgttggtgcaatgccagagatgggattgtcagccaccacactgccaccaccctgcacacagtctgggtccctccgagagaagcacgccaaccttaacatcccctacagcatcttggtgcttcacacaccatttaggaggccaccctaacgaggcaagaggacatgggggtgtgcagaagttctgttcttagtgagaatggctggcctgagaatccagctcacctcctctgcccacagtctggactgcttgtgggaaggccatctcctcctgtctggtggtacctccactctgggcagggagggcctgtctgtgactcgctctggaccccacttcccgctctggccaagggctgtcttctgtgcacatagctcaggagcctgcagcagttccctgtatgggtggatgtcctcaggggccaagaagagaagaatggggacaacagaaacctgctttgtaggggattatgtagactaaaagcctagaagttctgcccacatccttatgacgcagccaatctggagcttcatgtttccttctaaaagtagtaaccgggtagaagtgggtgacccattgaggacacatgatgtgaggtatttctgccggattctaggttagcaaagactcaaatgggtgactcatgaatgaagggagaacaggcacaggacttaatgaaaagagtttcttgaacttagttttctgaatgggggtggggagttggggcacgtgtgtgtaaggggaggctgcctcactttgaaggaatggtgttggctaacaggatccatgaaattcctaggtcagttgaataataactgaactactggtttgactgtggattatttcctgggtattagtgggacccaacagcacattgctattaatagtatggaaataatggtccctctgtttcattgaattgctgaagtaatgataatgccatgaaccaggagaagatggttgtgggggtttctaggaagcagctgctgtgacaggccaatcccaggcttgcccccgagccctcctgtccttctgggtttgtgtttgccttgcctggtgcttcctccctcattgtgttgttgaatagacctaggcagccttgtatccatagaaagcctccactgctgggccggggagggggttgtggtaagggccctctggaaatcaagcagagaatgcctttgcagtggtctcccgggcattgggcagggcctagccttttgcagcccccagaggaccttgcctgcataaagcactcagaagggttagccacctggtgattttgtctctagtgaaactgtgtttgccgataatcatccacatagccacctctgtcctcgcagtttggatgcctttttttgacacctgcgctaggttcttgtatgctggcttttcttaaaggaacagcagagtagaaaagaggttgagaatgttttctagcaggcagaatgtgcatacatgttttcatgagtgtcctttgggtgctgtttcttttaaatcctctgtgcacagggctctggcctttagtaaactgtttttctgtcttacgtcatgctgactgggtgctaggggctgattacaaaggggaagagttgaacagacatcaggggccgatgaaaccaaaggactaggagtcaggagaacaagtcagggattaggagacagcggtttggtttattgttatccagctggaggactcctaggggcagcagcaggaggaataccagggccacggaggggccaggagtctcacagtggagggcagactctaacagatgccagctgaacgctcgctggccctggatgtcatacgagttggggaccagaaatctgggctcagagaacccgtccagggagatttgaagccatgggttatcttctagagttgatactgataatatattttaatttttattgatgtttaataccttctgaaacaggagggtaagatcagatgggaagcccctctgttgaaggatcttgggaaccttggtggttttttttttttttttggttttttttttttgatcgagctgtggacatccttcttaattcgattctgaggatttgtttaactaaaaagttcccaaacacagaaagggcctccccacctgctttggggagctgtctgtgctgggagtgccaggcatcccatgggacccatcactgccagtgtctgtgcctcccagaggtcagccgtgtctgccctggctctgtctcctctgtgacagggcagagcatttctggtcagtttctccatggtgcctcccacccctttgtaaagtggatggacatgatggaattcagttgtctcaccctgatagcctgggtgttgatattcactttacccgcactcagacacaggcgaccttgaagcagttctcggtgtgtagagtccacgtgacagtccccacagcctccccagatagctgtgtgcctgtgcgctactgctgtgccattttcccaacttggcgtttcactaaatgcagctgatctctctctctgtgcactcgtgatccatgttgaacaatacatgtaggttctttttccacgcaatgtaagaacatgatatactgtacgttggaaagcatttaccttatttatatacctgaatgttcctactacacaaataaacatatattaaattcta
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:8760 -> Molecular function: GO:0004605 [phosphatidate cytidylyltransferase activity] evidence: NAS
            GeneID:8760 -> Biological process: GO:0006644 [phospholipid metabolic process] evidence: TAS
            GeneID:8760 -> Biological process: GO:0006655 [phosphatidylglycerol biosynthetic process] evidence: TAS
            GeneID:8760 -> Biological process: GO:0008654 [phospholipid biosynthetic process] evidence: NAS
            GeneID:8760 -> Biological process: GO:0016024 [CDP-diacylglycerol biosynthetic process] evidence: IEA
            GeneID:8760 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
            GeneID:8760 -> Biological process: GO:0046474 [glycerophospholipid biosynthetic process] evidence: TAS
            GeneID:8760 -> Cellular component: GO:0005743 [mitochondrial inner membrane] evidence: NAS
            GeneID:8760 -> Cellular component: GO:0005743 [mitochondrial inner membrane] evidence: TAS
            GeneID:8760 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: IEA
            GeneID:8760 -> Cellular component: GO:0016021 [integral to membrane] evidence: NAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_003809 -> EC 2.7.7.41

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.