Home |
Help |
Advanced search
2024-04-26 10:31:44, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_003811 1680 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens tumor necrosis factor (ligand) superfamily, member 9
(TNFSF9), mRNA.
ACCESSION NM_003811
VERSION NM_003811.3 GI:209954675
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1680)
AUTHORS Zhao,S., Zhang,H., Xing,Y. and Natkunam,Y.
TITLE CD137 ligand is expressed in primary and secondary lymphoid
follicles and in B-cell lymphomas: diagnostic and therapeutic
implications
JOURNAL Am. J. Surg. Pathol. 37 (2), 250-258 (2013)
PUBMED 23095505
REMARK GeneRIF: CD137L is a novel diagnostic marker of subtypes of
non-Hodgkin B-cell lymphomas.
REFERENCE 2 (bases 1 to 1680)
AUTHORS Park,S.J., Kim,H.J., Lee,J.S., Cho,H.R. and Kwon,B.
TITLE Reverse signaling through the co-stimulatory ligand, CD137L, as a
critical mediator of sterile inflammation
JOURNAL Mol. Cells 33 (6), 533-537 (2012)
PUBMED 22526397
REMARK GeneRIF: signaling through CD137L in non-hematopoietic cells such
as epithelial cells and endothelial cells has been shown to play an
essential role in sterile inflammation by regulating immune cell
recruitment. [Review]
Review article
REFERENCE 3 (bases 1 to 1680)
AUTHORS Dowell,A.C., Oldham,K.A., Bhatt,R.I., Lee,S.P. and Searle,P.F.
TITLE Long-term proliferation of functional human NK cells, with
conversion of CD56(dim) NK cells to a CD56 (bright) phenotype,
induced by carcinoma cells co-expressing 4-1BBL and IL-12
JOURNAL Cancer Immunol. Immunother. 61 (5), 615-628 (2012)
PUBMED 22021067
REMARK GeneRIF: Stimulation of non-adherent PBMC with OVCAR-3 cells
expressing 4-1BB ligand (4-1BBL) or IL-12 resulted in preferential
expansion of the NK cell population.
REFERENCE 4 (bases 1 to 1680)
AUTHORS Wu,C., Guo,H., Wang,Y., Gao,Y., Zhu,Z. and Du,Z.
TITLE Extracellular domain of human 4-1BBL enhanced the function of
cytotoxic T-lymphocyte induced by dendritic cell
JOURNAL Cell. Immunol. 271 (1), 118-123 (2011)
PUBMED 21745658
REMARK GeneRIF: Data indicate that ex4-1BBL augments 4-1BB expression not
only on the primed T cell, but also on DC.
REFERENCE 5 (bases 1 to 1680)
AUTHORS Watts,T.H., Lin,G.H., Wang,C., McPherson,A.J., Snell,L.M. and
Sabbagh,L.
TITLE Role of 4-1BBL and TRAF1 in the CD8 T cell response to influenza
virus and HIV
JOURNAL Adv. Exp. Med. Biol. 691, 177-186 (2011)
PUBMED 21153322
REMARK GeneRIF: 4-1BBL and TRAF1 in the CD8 T cell response to influenza
virus and HIV
Review article
REFERENCE 6 (bases 1 to 1680)
AUTHORS Saoulli,K., Lee,S.Y., Cannons,J.L., Yeh,W.C., Santana,A.,
Goldstein,M.D., Bangia,N., DeBenedette,M.A., Mak,T.W., Choi,Y. and
Watts,T.H.
TITLE CD28-independent, TRAF2-dependent costimulation of resting T cells
by 4-1BB ligand
JOURNAL J. Exp. Med. 187 (11), 1849-1862 (1998)
PUBMED 9607925
REFERENCE 7 (bases 1 to 1680)
AUTHORS Arch,R.H. and Thompson,C.B.
TITLE 4-1BB and Ox40 are members of a tumor necrosis factor (TNF)-nerve
growth factor receptor subfamily that bind TNF receptor-associated
factors and activate nuclear factor kappaB
JOURNAL Mol. Cell. Biol. 18 (1), 558-565 (1998)
PUBMED 9418902
REFERENCE 8 (bases 1 to 1680)
AUTHORS Loo,D.T., Chalupny,N.J., Bajorath,J., Shuford,W.W., Mittler,R.S.
and Aruffo,A.
TITLE Analysis of 4-1BBL and laminin binding to murine 4-1BB, a member of
the tumor necrosis factor receptor superfamily, and comparison with
human 4-1BB
JOURNAL J. Biol. Chem. 272 (10), 6448-6456 (1997)
PUBMED 9045669
REFERENCE 9 (bases 1 to 1680)
AUTHORS Alderson,M.R., Smith,C.A., Tough,T.W., Davis-Smith,T.,
Armitage,R.J., Falk,B., Roux,E., Baker,E., Sutherland,G.R. and
Din,W.S.
TITLE Molecular and biological characterization of human 4-1BB and its
ligand
JOURNAL Eur. J. Immunol. 24 (9), 2219-2227 (1994)
PUBMED 8088337
REFERENCE 10 (bases 1 to 1680)
AUTHORS Goodwin,R.G., Din,W.S., Davis-Smith,T., Anderson,D.M., Gimpel,S.D.,
Sato,T.A., Maliszewski,C.R., Brannan,C.I., Copeland,N.G.,
Jenkins,N.A. et al.
TITLE Molecular cloning of a ligand for the inducible T cell gene 4-1BB:
a member of an emerging family of cytokines with homology to tumor
necrosis factor
JOURNAL Eur. J. Immunol. 23 (10), 2631-2641 (1993)
PUBMED 8405064
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AC010503.8 and BX107825.1.
On Oct 24, 2008 this sequence version replaced gi:24119163.
Summary: The protein encoded by this gene is a cytokine that
belongs to the tumor necrosis factor (TNF) ligand family. This
transmembrane cytokine is a bidirectional signal transducer that
acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory
receptor molecule in T lymphocytes. This cytokine and its receptor
are involved in the antigen presentation process and in the
generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is
absent from resting T lymphocytes but rapidly expressed upon
antigenic stimulation. The ligand encoded by this gene,
TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes
in addition to promoting T lymphocyte proliferation. This cytokine
has also been shown to be required for the optimal CD8 responses in
CD8 T cells. This cytokine is expressed in carcinoma cell lines,
and is thought to be involved in T cell-tumor cell
interaction.[provided by RefSeq, Oct 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: U03398.1, BM545061.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025087 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-305 AC010503.8 94689-94993
306-336 AC010503.8 96476-96506
337-1598 AC010503.8 98290-99551
1599-1680 BX107825.1 341-422
FEATURES Location/Qualifiers
source 1..1680
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19p13.3"
gene 1..1680
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/note="tumor necrosis factor (ligand) superfamily, member
9"
/db_xref="GeneID:8744"
/db_xref="HGNC:11939"
/db_xref="HPRD:05861"
/db_xref="MIM:606182"
exon 1..305
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/inference="alignment:Splign:1.39.8"
STS 11..880
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/db_xref="UniSTS:485605"
variation 17
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:370221849"
variation 19
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:2234173"
variation 25
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:200266919"
STS 28..890
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/db_xref="UniSTS:481356"
CDS 39..803
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/note="receptor 4-1BB ligand; homolog of mouse 4-1BB-L;
4-1BBL"
/codon_start=1
/product="tumor necrosis factor ligand superfamily member
9"
/protein_id="NP_003802.1"
/db_xref="GI:4507609"
/db_xref="CCDS:CCDS12169.1"
/db_xref="GeneID:8744"
/db_xref="HGNC:11939"
/db_xref="HPRD:05861"
/db_xref="MIM:606182"
/translation="
MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
"
misc_feature 123..185
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P41273.1);
transmembrane region"
misc_feature 309..752
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/note="Tumor Necrosis Factor; TNF superfamily members
include the cytokines: TNF (TNF-alpha), LT
(lymphotoxin-alpha, TNF-beta), CD40 ligand, Apo2L (TRAIL),
Fas ligand, and osteoprotegerin (OPG) ligand. These
proteins generally have an intracellular N-terminal...;
Region: TNF; cd00184"
/db_xref="CDD:29146"
misc_feature order(318..320,462..464,468..470,633..635,648..650,
738..740,750..752)
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/note="trimer interface [polypeptide binding]; other site"
/db_xref="CDD:29146"
misc_feature order(366..371,384..386,522..524,543..545,564..566)
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/note="receptor binding sites; other site"
/db_xref="CDD:29146"
variation 53
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="t"
/db_xref="dbSNP:150427368"
variation 87
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="g"
/db_xref="dbSNP:442511"
variation 132
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:199772971"
variation 162
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:2234174"
variation 210
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="g"
/replace="t"
/db_xref="dbSNP:199791725"
variation 233
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="g"
/db_xref="dbSNP:201443100"
variation 272
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="g"
/db_xref="dbSNP:368392154"
variation 276
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="g"
/replace="t"
/db_xref="dbSNP:2234175"
exon 306..336
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/inference="alignment:Splign:1.39.8"
exon 337..1665
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/inference="alignment:Splign:1.39.8"
variation 356
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="g"
/db_xref="dbSNP:369015928"
variation 366
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:372558158"
variation 368
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:61749999"
variation 369
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:140032775"
variation 376
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:377044973"
variation 435
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:370634705"
variation 454
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="g"
/db_xref="dbSNP:61750000"
variation 476
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:200886490"
variation 483
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="c"
/db_xref="dbSNP:146406969"
variation 486
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:77313944"
variation 487
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:112025865"
variation 501
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:375400132"
variation 529
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:61760044"
variation 530
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:150951150"
variation 539
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:377614568"
variation 549
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:374312384"
variation 567
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:34989544"
variation 569
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:370981091"
variation 585
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:199748081"
variation 629
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:375425240"
variation 662
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:201323170"
variation 663
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:201304601"
variation 711
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:201036031"
variation 724
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:372880514"
variation 731
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:199934773"
variation 740
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="c"
/db_xref="dbSNP:72987335"
variation 743
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="g"
/db_xref="dbSNP:367836263"
variation 776
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:61733920"
variation 777
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:2234180"
variation 782
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="g"
/db_xref="dbSNP:201004514"
variation 790
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:184642529"
variation 791
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:2234181"
variation 804
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:75982228"
variation 806
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:2234182"
variation 840
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:114569072"
STS 882..1081
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/standard_name="SHGC-35317"
/db_xref="UniSTS:33468"
STS 888..1102
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/standard_name="G15865"
/db_xref="UniSTS:50940"
variation 1024..1025
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace=""
/replace="ta"
/db_xref="dbSNP:139412297"
variation 1025..1026
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace=""
/replace="ta"
/db_xref="dbSNP:373903839"
variation 1040..1041
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace=""
/replace="at"
/db_xref="dbSNP:72194350"
variation 1041..1042
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace=""
/replace="at"
/db_xref="dbSNP:57826954"
variation 1098..1100
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace=""
/replace="ggg"
/db_xref="dbSNP:59499802"
variation 1098
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace=""
/replace="g"
/replace="ggg"
/db_xref="dbSNP:10712707"
variation 1102
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace=""
/replace="cc"
/replace="ccc"
/db_xref="dbSNP:4028197"
variation 1224
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:3865469"
variation 1363
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:348389"
variation 1397..1401
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace=""
/replace="tcttt"
/db_xref="dbSNP:370491099"
variation 1399
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:1042455"
variation 1452
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="t"
/db_xref="dbSNP:146939786"
variation 1492
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="c"
/replace="g"
/db_xref="dbSNP:10419225"
variation 1527
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="g"
/db_xref="dbSNP:3865470"
variation 1541
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="a"
/replace="c"
/db_xref="dbSNP:181863971"
polyA_signal 1639..1644
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
variation 1648
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
/replace="g"
/replace="t"
/db_xref="dbSNP:184938692"
polyA_site 1665
/gene="TNFSF9"
/gene_synonym="4-1BB-L; CD137L"
ORIGIN
aaaaagcggcgcgctgtgtcttcccgcagtctctcgtcatggaatacgcctctgacgcttcactggaccccgaagccccgtggcctcccgcgccccgcgctcgcgcctgccgcgtactgccttgggccctggtcgcggggctgctgctgctgctgctgctcgctgccgcctgcgccgtcttcctcgcctgcccctgggccgtgtccggggctcgcgcctcgcccggctccgcggccagcccgagactccgcgagggtcccgagctttcgcccgacgatcccgccggcctcttggacctgcggcagggcatgtttgcgcagctggtggcccaaaatgttctgctgatcgatgggcccctgagctggtacagtgacccaggcctggcaggcgtgtccctgacggggggcctgagctacaaagaggacacgaaggagctggtggtggccaaggctggagtctactatgtcttctttcaactagagctgcggcgcgtggtggccggcgagggctcaggctccgtttcacttgcgctgcacctgcagccactgcgctctgctgctggggccgccgccctggctttgaccgtggacctgccacccgcctcctccgaggctcggaactcggccttcggtttccagggccgcttgctgcacctgagtgccggccagcgcctgggcgtccatcttcacactgaggccagggcacgccatgcctggcagcttacccagggcgccacagtcttgggactcttccgggtgacccccgaaatcccagccggactcccttcaccgaggtcggaataacgtccagcctgggtgcagcccacctggacagagtccgaatcctactccatccttcatggagacccctggtgctgggtccctgctgctttctctacctcaaggggcttggcaggggtccctgctgctgacctccccttgaggaccctcctcacccactccttccccaagttggaccttgatatttattctgagcctgagctcagataatatattatatatattatatatatatatatatttctatttaaagaggatcctgagtttgtgaatggacttttttagaggagttgttttgggggggggggggtcttcgacattgccgaggctggtcttgaactcctggacttagacgatcctcctgcctcagcctcccaagcaactgggattcatcctttctattaattcattgtacttatttgcttatttgtgtgtattgagcatctgtaatgtgccagcattgtgcccaggctagggggctatagaaacatctagaaatagactgaaagaaaatctgagttatggtaatacgtgaggaatttaaagactcatccccagcctccacctcctgtgtgatacttgggggctagcttttttctttctttcttttttttgagatggtcttgttctgtcaaccaggctagaatgcagcggtgcaatcatgagtcaatgcagcctccagcctcgacctcccgaggctcaggtgatcctcccatctcagcctctcgagtagctgggaccacagttgtgtgccaccacacttggctaactttttaatttttttgcggagacggtattgctatgttgccaaggttgtttacatgccagtacaatttataataaacactcatttttcctccctctgaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:8744 -> Molecular function: GO:0005102 [receptor binding] evidence: TAS
GeneID:8744 -> Molecular function: GO:0005125 [cytokine activity] evidence: IEA
GeneID:8744 -> Molecular function: GO:0005164 [tumor necrosis factor receptor binding] evidence: IEA
GeneID:8744 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:8744 -> Biological process: GO:0006955 [immune response] evidence: IEA
GeneID:8744 -> Biological process: GO:0007165 [signal transduction] evidence: TAS
GeneID:8744 -> Biological process: GO:0007267 [cell-cell signaling] evidence: TAS
GeneID:8744 -> Biological process: GO:0008283 [cell proliferation] evidence: TAS
GeneID:8744 -> Biological process: GO:0042127 [regulation of cell proliferation] evidence: IEA
GeneID:8744 -> Cellular component: GO:0005615 [extracellular space] evidence: IEA
GeneID:8744 -> Cellular component: GO:0005886 [plasma membrane] evidence: IEA
GeneID:8744 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.