Home |
Help |
Advanced search
2024-04-25 23:17:28, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_003809 1407 bp mRNA linear PRI 16-JUN-2013
DEFINITION Homo sapiens tumor necrosis factor (ligand) superfamily, member 12
(TNFSF12), transcript variant 1, mRNA.
ACCESSION NM_003809
VERSION NM_003809.2 GI:23510442
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1407)
AUTHORS Pellegrini,M., Willen,L., Perroud,M., Krushinskie,D., Strauch,K.,
Cuervo,H., Day,E.S., Schneider,P. and Zheng,T.S.
TITLE Structure of the extracellular domains of human and Xenopus Fn14:
implications in the evolution of TWEAK and Fn14 interactions
JOURNAL FEBS J. 280 (8), 1818-1829 (2013)
PUBMED 23438059
REMARK GeneRIF: TWEAK binds to hFn14 by surface plasmon resonance (View
interaction) xeFn14 binds to TWEAK by enzyme linked immunosorbent
assay
REFERENCE 2 (bases 1 to 1407)
AUTHORS Wang,H.Y., Ma,C.A., Zhao,Y., Fan,X., Zhou,Q., Edmonds,P., Uzel,G.,
Oliveira,J.B., Orange,J. and Jain,A.
TITLE Antibody deficiency associated with an inherited autosomal dominant
mutation in TWEAK
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 110 (13), 5127-5132 (2013)
PUBMED 23493554
REMARK GeneRIF: data implicate TWEAK as a disease-susceptibility gene for
a humoral immunodeficiency.
REFERENCE 3 (bases 1 to 1407)
AUTHORS Moreno,J.A., Sastre,C., Madrigal-Matute,J., Munoz-Garcia,B.,
Ortega,L., Burkly,L.C., Egido,J., Martin-Ventura,J.L. and
Blanco-Colio,L.M.
TITLE HMGB1 expression and secretion are increased via TWEAK-Fn14
interaction in atherosclerotic plaques and cultured monocytes
JOURNAL Arterioscler. Thromb. Vasc. Biol. 33 (3), 612-620 (2013)
PUBMED 23288170
REMARK GeneRIF: TWEAK/Fn14 can regulate expression and secretion of HMGB1
in monocytes/macrophages, participating in the inflammatory
response associated with atherosclerotic plaque development.
REFERENCE 4 (bases 1 to 1407)
AUTHORS Llaurado,G., Gonzalez-Clemente,J.M., Maymo-Masip,E., Subias,D.,
Vendrell,J. and Chacon,M.R.
TITLE Serum levels of TWEAK and scavenger receptor CD163 in type 1
diabetes mellitus: relationship with cardiovascular risk factors. a
case-control study
JOURNAL PLoS ONE 7 (8), E43919 (2012)
PUBMED 22937125
REMARK GeneRIF: sTWEAK is decreased in type 1 diabetes mellitus patients
compared with age and sex-matched healthy subjects
REFERENCE 5 (bases 1 to 1407)
AUTHORS Roos,C., Wicovsky,A., Muller,N., Salzmann,S., Rosenthal,T.,
Kalthoff,H., Trauzold,A., Seher,A., Henkler,F., Kneitz,C. and
Wajant,H.
TITLE Soluble and transmembrane TNF-like weak inducer of apoptosis
differentially activate the classical and noncanonical NF-kappa B
pathway
JOURNAL J. Immunol. 185 (3), 1593-1605 (2010)
PUBMED 20610643
REMARK GeneRIF: Membrane TWEAK is superior to soluble TWEAK with respect
to activation of the classical NF-kappa B pathway, whereas both
TWEAK variants are potent inducers of TNFR-associated factor-2
depletion, NF-kappaB-inducing kinase accumulation and p100
processing.
REFERENCE 6 (bases 1 to 1407)
AUTHORS Brown,S.A., Ghosh,A. and Winkles,J.A.
TITLE Full-length, membrane-anchored TWEAK can function as a juxtacrine
signaling molecule and activate the NF-kappaB pathway
JOURNAL J. Biol. Chem. 285 (23), 17432-17441 (2010)
PUBMED 20385556
REMARK GeneRIF: Full-length, membrane-anchored TWEAK can function as a
juxtacrine signaling molecule and activate the NF-kappaB pathway
REFERENCE 7 (bases 1 to 1407)
AUTHORS Kaplan,M.J., Ray,D., Mo,R.R., Yung,R.L. and Richardson,B.C.
TITLE TRAIL (Apo2 ligand) and TWEAK (Apo3 ligand) mediate CD4+ T cell
killing of antigen-presenting macrophages
JOURNAL J. Immunol. 164 (6), 2897-2904 (2000)
PUBMED 10706675
REFERENCE 8 (bases 1 to 1407)
AUTHORS Lynch,C.N., Wang,Y.C., Lund,J.K., Chen,Y.W., Leal,J.A. and
Wiley,S.R.
TITLE TWEAK induces angiogenesis and proliferation of endothelial cells
JOURNAL J. Biol. Chem. 274 (13), 8455-8459 (1999)
PUBMED 10085077
REFERENCE 9 (bases 1 to 1407)
AUTHORS Marsters,S.A., Sheridan,J.P., Pitti,R.M., Brush,J., Goddard,A. and
Ashkenazi,A.
TITLE Identification of a ligand for the death-domain-containing receptor
Apo3
JOURNAL Curr. Biol. 8 (9), 525-528 (1998)
PUBMED 9560343
REFERENCE 10 (bases 1 to 1407)
AUTHORS Chicheportiche,Y., Bourdon,P.R., Xu,H., Hsu,Y.M., Scott,H.,
Hession,C., Garcia,I. and Browning,J.L.
TITLE TWEAK, a new secreted ligand in the tumor necrosis factor family
that weakly induces apoptosis
JOURNAL J. Biol. Chem. 272 (51), 32401-32410 (1997)
PUBMED 9405449
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AI091441.1, BC104420.1,
AF030099.1 and AF055872.1.
On Oct 7, 2002 this sequence version replaced gi:4507596.
Summary: The protein encoded by this gene is a cytokine that
belongs to the tumor necrosis factor (TNF) ligand family. This
protein is a ligand for the FN14/TWEAKR receptor. This cytokine has
overlapping signaling functions with TNF, but displays a much wider
tissue distribution. This cytokine, which exists in both
membrane-bound and secreted forms, can induce apoptosis via
multiple pathways of cell death in a cell type-specific manner.
This cytokine is also found to promote proliferation and migration
of endothelial cells, and thus acts as a regulator of angiogenesis.
Alternative splicing results in multiple transcript variants. Some
transcripts skip the last exon of this gene and continue into the
second exon of the neighboring TNFSF13 gene; such read-through
transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.
[provided by RefSeq, Oct 2010].
Transcript Variant: This variant (1) represents the shorter
transcript but encodes the functional protein.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AF055872.1, AF030099.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-64 AI091441.1 168-231
65-1062 BC104420.1 1-998
1063-1384 AF030099.1 984-1305
1385-1407 AF055872.1 1346-1368
FEATURES Location/Qualifiers
source 1..1407
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="17"
/map="17p13"
gene 1..1407
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/note="tumor necrosis factor (ligand) superfamily, member
12"
/db_xref="GeneID:8742"
/db_xref="HGNC:11927"
/db_xref="HPRD:04074"
/db_xref="MIM:602695"
exon 1..255
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/inference="alignment:Splign:1.39.8"
variation 9
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:8074608"
STS 65..1062
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/db_xref="UniSTS:484141"
variation 69
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:369618628"
CDS 97..846
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/note="proprotein is encoded by transcript variant 1;
APO3/DR3 ligand; TNF-related WEAK inducer of apoptosis;
APO3 ligand"
/codon_start=1
/product="tumor necrosis factor ligand superfamily member
12 proprotein"
/protein_id="NP_003800.1"
/db_xref="GI:4507597"
/db_xref="CCDS:CCDS11109.1"
/db_xref="GeneID:8742"
/db_xref="HGNC:11927"
/db_xref="HPRD:04074"
/db_xref="MIM:602695"
/translation="
MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
"
proprotein 97..843
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/product="tumor necrosis factor ligand superfamily member
12, membrane form"
misc_feature 160..222
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (O43508.1);
transmembrane region"
misc_feature 373..378
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/experiment="experimental evidence, no additional details
recorded"
/note="Cleavage; propagated from UniProtKB/Swiss-Prot
(O43508.1); cleavage site"
mat_peptide 376..843
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/product="tumor necrosis factor ligand superfamily member
12, secreted form"
misc_feature 415..834
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/note="Tumor Necrosis Factor; TNF superfamily members
include the cytokines: TNF (TNF-alpha), LT
(lymphotoxin-alpha, TNF-beta), CD40 ligand, Apo2L (TRAIL),
Fas ligand, and osteoprotegerin (OPG) ligand. These
proteins generally have an intracellular N-terminal...;
Region: TNF; cd00184"
/db_xref="CDD:29146"
misc_feature order(424..426,580..582,586..588,727..729,742..744,
820..822,832..834)
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/note="trimer interface [polypeptide binding]; other site"
/db_xref="CDD:29146"
misc_feature order(496..501,514..516,622..624,643..645,658..660)
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/note="receptor binding sites; other site"
/db_xref="CDD:29146"
misc_feature 763..765
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
variation 163
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="t"
/db_xref="dbSNP:112774414"
variation 168
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="t"
/db_xref="dbSNP:77711855"
exon 256..303
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/inference="alignment:Splign:1.39.8"
exon 304..379
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/inference="alignment:Splign:1.39.8"
variation 341
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="t"
/db_xref="dbSNP:370085069"
variation 372
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="c"
/db_xref="dbSNP:62059804"
exon 380..433
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/inference="alignment:Splign:1.39.8"
variation 400
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="t"
/db_xref="dbSNP:150816164"
variation 413
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="t"
/db_xref="dbSNP:369851985"
variation 417
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="t"
/db_xref="dbSNP:139642600"
exon 434..469
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/inference="alignment:Splign:1.39.8"
variation 449
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:144468031"
variation 453
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:147826685"
variation 456
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="t"
/db_xref="dbSNP:141377098"
variation 457
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:200558366"
variation 461
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="t"
/db_xref="dbSNP:145233196"
exon 470..594
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/inference="alignment:Splign:1.39.8"
variation 497
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:201582547"
variation 523
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="c"
/db_xref="dbSNP:199718449"
variation 536
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="t"
/db_xref="dbSNP:371762842"
variation 539
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:200059075"
variation 546
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="t"
/db_xref="dbSNP:147597489"
variation 566
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:371341735"
exon 595..1386
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/inference="alignment:Splign:1.39.8"
variation 595
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace=""
/replace="g"
/db_xref="dbSNP:35844756"
variation 650
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:149050050"
variation 692..693
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace=""
/replace="a"
/db_xref="dbSNP:35826004"
variation 693
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:143039184"
variation 696
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="g"
/db_xref="dbSNP:3803798"
variation 705
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="t"
/db_xref="dbSNP:140608168"
variation 719
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:376560567"
variation 720
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="c"
/db_xref="dbSNP:61761339"
variation 738
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="g"
/replace="t"
/db_xref="dbSNP:4968189"
variation 752
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:3803799"
variation 802
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="g"
/db_xref="dbSNP:376444597"
variation 825
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="t"
/db_xref="dbSNP:200770110"
variation 864
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:1128963"
variation 866
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:374296703"
variation 922
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:113147008"
variation 937
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="a"
/replace="g"
/db_xref="dbSNP:28362665"
variation 1085
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="g"
/db_xref="dbSNP:75016989"
variation 1136
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="g"
/replace="t"
/db_xref="dbSNP:9907657"
STS 1171..1305
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/standard_name="RH98958"
/db_xref="UniSTS:85338"
variation 1212
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="t"
/db_xref="dbSNP:112438437"
variation 1293
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
/replace="c"
/replace="t"
/db_xref="dbSNP:28362666"
polyA_signal 1367..1372
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
polyA_site 1377
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
polyA_site 1386
/gene="TNFSF12"
/gene_synonym="APO3L; DR3LG; TWEAK"
ORIGIN
ctctccccggcccgatccgcccgccggctccccctcccccgatccctcgggtcccgggatgggggggcggtgaggcaggcacagccccccgcccccatggccgcccgtcggagccagaggcggagggggcgccggggggagccgggcaccgccctgctggtcccgctcgcgctgggcctgggcctggcgctggcctgcctcggcctcctgctggccgtggtcagtttggggagccgggcatcgctgtccgcccaggagcctgcccaggaggagctggtggcagaggaggaccaggacccgtcggaactgaatccccagacagaagaaagccaggatcctgcgcctttcctgaaccgactagttcggcctcgcagaagtgcacctaaaggccggaaaacacgggctcgaagagcgatcgcagcccattatgaagttcatccacgacctggacaggacggagcgcaggcaggtgtggacgggacagtgagtggctgggaggaagccagaatcaacagctccagccctctgcgctacaaccgccagatcggggagtttatagtcacccgggctgggctctactacctgtactgtcaggtgcactttgatgaggggaaggctgtctacctgaagctggacttgctggtggatggtgtgctggccctgcgctgcctggaggaattctcagccactgcggcgagttccctcgggccccagctccgcctctgccaggtgtctgggctgttggccctgcggccagggtcctccctgcggatccgcaccctcccctgggcccatctcaaggctgcccccttcctcacctacttcggactcttccaggttcactgaggggccctggtctccccgcagtcgtcccaggctgccggctcccctcgacagctctctgggcacccggtcccctctgccccaccctcagccgctctttgctccagacctgcccctccctctagaggctgcctgggcctgttcacgtgttttccatcccacataaatacagtattcccactcttatcttacaactcccccaccgcccactctccacctcactagctccccaatccctgaccctttgaggcccccagtgatctcgactcccccctggccacagacccccagggcattgtgttcactgtactctgtgggcaaggatgggtccagaagaccccacttcaggcactaagaggggctggacctggcggcaggaagccaaagagactgggcctaggccaggagttcccaaatgtgaggggcgagaaacaagacaagctcctcccttgagaattccctgtggatttttaaaacagatattatttttattattattgtgacaaaatgttgataaatggatattaaatagaataagtcataaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:8742 -> Molecular function: GO:0005102 [receptor binding] evidence: TAS
GeneID:8742 -> Molecular function: GO:0005125 [cytokine activity] evidence: IEA
GeneID:8742 -> Molecular function: GO:0005125 [cytokine activity] evidence: TAS
GeneID:8742 -> Molecular function: GO:0005164 [tumor necrosis factor receptor binding] evidence: IEA
GeneID:8742 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:8742 -> Biological process: GO:0001525 [angiogenesis] evidence: IEA
GeneID:8742 -> Biological process: GO:0001938 [positive regulation of endothelial cell proliferation] evidence: TAS
GeneID:8742 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:8742 -> Biological process: GO:0006917 [induction of apoptosis] evidence: TAS
GeneID:8742 -> Biological process: GO:0006955 [immune response] evidence: IEA
GeneID:8742 -> Biological process: GO:0007165 [signal transduction] evidence: TAS
GeneID:8742 -> Biological process: GO:0030154 [cell differentiation] evidence: IEA
GeneID:8742 -> Biological process: GO:0043542 [endothelial cell migration] evidence: TAS
GeneID:8742 -> Biological process: GO:0045766 [positive regulation of angiogenesis] evidence: TAS
GeneID:8742 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: TAS
GeneID:8742 -> Biological process: GO:2001238 [positive regulation of extrinsic apoptotic signaling pathway] evidence: IDA
GeneID:8742 -> Cellular component: GO:0005615 [extracellular space] evidence: IEA
GeneID:8742 -> Cellular component: GO:0005615 [extracellular space] evidence: TAS
GeneID:8742 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS
GeneID:8742 -> Cellular component: GO:0048471 [perinuclear region of cytoplasm] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.