Home |
Help |
Advanced search
2024-04-25 17:27:28, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_003685 3262 bp mRNA linear PRI 16-JUN-2013
DEFINITION Homo sapiens KH-type splicing regulatory protein (KHSRP), mRNA.
ACCESSION NM_003685
VERSION NM_003685.2 GI:154354999
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3262)
AUTHORS Bhattacharyya,S., Kumar,P., Tsuchiya,M., Bhattacharyya,A. and
Biswas,R.
TITLE Regulation of miR-155 biogenesis in cystic fibrosis lung epithelial
cells: antagonistic role of two mRNA-destabilizing proteins, KSRP
and TTP
JOURNAL Biochem. Biophys. Res. Commun. 433 (4), 484-488 (2013)
PUBMED 23524258
REMARK GeneRIF: KSRP induces enhanced processing of pri- and pre-miR-155
in cystic fibrosis lung epithelial cells.
REFERENCE 2 (bases 1 to 3262)
AUTHORS Chen,L.L., Kung,Y.A., Weng,K.F., Lin,J.Y., Horng,J.T. and Shih,S.R.
TITLE Enterovirus 71 infection cleaves a negative regulator for viral
internal ribosomal entry site-driven translation
JOURNAL J. Virol. 87 (7), 3828-3838 (2013)
PUBMED 23345520
REMARK GeneRIF: Enterovirus 71 infection cleaved FBP2, which altered its
function when its carboxyl terminus was cleaved.
REFERENCE 3 (bases 1 to 3262)
AUTHORS Nicastro,G., Garcia-Mayoral,M.F., Hollingworth,D., Kelly,G.,
Martin,S.R., Briata,P., Gherzi,R. and Ramos,A.
TITLE Noncanonical G recognition mediates KSRP regulation of let-7
biogenesis
JOURNAL Nat. Struct. Mol. Biol. 19 (12), 1282-1286 (2012)
PUBMED 23142982
REMARK GeneRIF: Binding of the human KSRP protein to let-7 miRNA
precursors positively regulates their processing to mature let-7,
thereby contributing to control of cell proliferation, apoptosis
and differentiation
REFERENCE 4 (bases 1 to 3262)
AUTHORS Otsuka,M., Takata,A., Yoshikawa,T., Kojima,K., Kishikawa,T.,
Shibata,C., Takekawa,M., Yoshida,H., Omata,M. and Koike,K.
TITLE Receptor for activated protein kinase C: requirement for efficient
microRNA function and reduced expression in hepatocellular
carcinoma
JOURNAL PLoS ONE 6 (9), E24359 (2011)
PUBMED 21935400
REMARK GeneRIF: RACK1 binds to KH-type splicing regulatory protein (KSRP),
a member of the Dicer complex, and is required for the recruitment
of mature miRNAs to the RNA-induced silencing complex (RISC).
REFERENCE 5 (bases 1 to 3262)
AUTHORS Gherzi,R., Chen,C.Y., Trabucchi,M., Ramos,A. and Briata,P.
TITLE The role of KSRP in mRNA decay and microRNA precursor maturation
JOURNAL Wiley Interdiscip Rev RNA 1 (2), 230-239 (2010)
PUBMED 21935887
REMARK GeneRIF: The role of KSRP in mRNA decay and microRNA precursor
maturation.
Review article
REFERENCE 6 (bases 1 to 3262)
AUTHORS Ring,H.Z., Vameghi-Meyers,V., Nikolic,J.M., Min,H., Black,D.L. and
Francke,U.
TITLE Mapping of the KHSRP gene to a region of conserved synteny on human
chromosome 19p13.3 and mouse chromosome 17
JOURNAL Genomics 56 (3), 350-352 (1999)
PUBMED 10087204
REFERENCE 7 (bases 1 to 3262)
AUTHORS Chou,M.Y., Rooke,N., Turck,C.W. and Black,D.L.
TITLE hnRNP H is a component of a splicing enhancer complex that
activates a c-src alternative exon in neuronal cells
JOURNAL Mol. Cell. Biol. 19 (1), 69-77 (1999)
PUBMED 9858532
REFERENCE 8 (bases 1 to 3262)
AUTHORS Min,H., Turck,C.W., Nikolic,J.M. and Black,D.L.
TITLE A new regulatory protein, KSRP, mediates exon inclusion through an
intronic splicing enhancer
JOURNAL Genes Dev. 11 (8), 1023-1036 (1997)
PUBMED 9136930
REFERENCE 9 (bases 1 to 3262)
AUTHORS Davis-Smyth,T., Duncan,R.C., Zheng,T., Michelotti,G. and Levens,D.
TITLE The far upstream element-binding proteins comprise an ancient
family of single-strand DNA-binding transactivators
JOURNAL J. Biol. Chem. 271 (49), 31679-31687 (1996)
PUBMED 8940189
REFERENCE 10 (bases 1 to 3262)
AUTHORS Dawson,S.J. and White,L.A.
TITLE Treatment of Haemophilus aphrophilus endocarditis with
ciprofloxacin
JOURNAL J. Infect. 24 (3), 317-320 (1992)
PUBMED 1602151
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
DC388502.1, BC085004.1, CF123311.1, U94832.1, CB216491.1,
BQ186683.1 and AA976482.1.
On Aug 1, 2007 this sequence version replaced gi:4504864.
Summary: The KHSRP gene encodes a multifunctional RNA-binding
protein implicated in a variety of cellular processes, including
transcription, alternative pre-mRNA splicing, and mRNA localization
(Min et al., 1997 [PubMed 9136930]; Gherzi et al., 2004 [PubMed
15175153]).[supplied by OMIM, Apr 2010].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: U94832.1, U69126.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025081, ERS025082 [ECO:0000350]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-36 DC388502.1 1-36
37-2023 BC085004.1 1-1987
2024-2187 CF123311.1 443-606
2188-2344 U94832.1 2171-2327
2345-2547 CB216491.1 431-633
2548-3010 U94832.1 2529-2991
3011-3223 BQ186683.1 448-660
3224-3262 AA976482.1 1-39 c
FEATURES Location/Qualifiers
source 1..3262
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19p13.3"
gene 1..3262
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/note="KH-type splicing regulatory protein"
/db_xref="GeneID:8570"
/db_xref="HGNC:6316"
/db_xref="MIM:603445"
exon 1..359
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
CDS 111..2246
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/note="FUSE binding protein 2; p75; FUSE-binding protein
2; KH type-splicing regulatory protein"
/codon_start=1
/product="far upstream element-binding protein 2"
/protein_id="NP_003676.2"
/db_xref="GI:154355000"
/db_xref="CCDS:CCDS45936.1"
/db_xref="GeneID:8570"
/db_xref="HGNC:6316"
/db_xref="MIM:603445"
/translation="
MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNWGPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQLIEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPHDPSKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ
"
misc_feature 408..410
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine; propagated from
UniProtKB/Swiss-Prot (Q92945.4); phosphorylation site"
misc_feature 546..734
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/note="K homology RNA-binding domain, type I. KH binds
single-stranded RNA or DNA. It is found in a wide variety
of proteins including ribosomal proteins, transcription
factors and post-transcriptional modifiers of mRNA. There
are two different KH domains that...; Region: KH-I;
cd00105"
/db_xref="CDD:29002"
misc_feature order(570..572,576..584,588..602,609..614,621..626,
639..650)
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/note="nucleic acid binding region [nucleotide binding];
other site"
/db_xref="CDD:29002"
misc_feature 591..602
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/note="G-X-X-G motif; other site"
/db_xref="CDD:29002"
misc_feature 651..653
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q92945.4); phosphorylation site"
misc_feature 687..689
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q92945.4); phosphorylation site"
misc_feature 813..1010
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/note="K homology RNA-binding domain, type I. KH binds
single-stranded RNA or DNA. It is found in a wide variety
of proteins including ribosomal proteins, transcription
factors and post-transcriptional modifiers of mRNA. There
are two different KH domains that...; Region: KH-I;
cd00105"
/db_xref="CDD:29002"
misc_feature order(837..839,843..851,855..869,876..881,888..893,
906..917)
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/note="nucleic acid binding region [nucleotide binding];
other site"
/db_xref="CDD:29002"
misc_feature 858..869
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/note="G-X-X-G motif; other site"
/db_xref="CDD:29002"
misc_feature 930..932
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q92945.4); phosphorylation site"
misc_feature 1083..1268
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/note="K homology RNA-binding domain, type I. KH binds
single-stranded RNA or DNA. It is found in a wide variety
of proteins including ribosomal proteins, transcription
factors and post-transcriptional modifiers of mRNA. There
are two different KH domains that...; Region: KH-I;
cd00105"
/db_xref="CDD:29002"
misc_feature order(1104..1106,1110..1118,1122..1136,1143..1148,
1155..1160,1173..1184)
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/note="nucleic acid binding region [nucleotide binding];
other site"
/db_xref="CDD:29002"
misc_feature 1125..1136
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/note="G-X-X-G motif; other site"
/db_xref="CDD:29002"
misc_feature 1386..1586
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/note="K homology RNA-binding domain, type I. KH binds
single-stranded RNA or DNA. It is found in a wide variety
of proteins including ribosomal proteins, transcription
factors and post-transcriptional modifiers of mRNA. There
are two different KH domains that...; Region: KH-I;
cd00105"
/db_xref="CDD:29002"
misc_feature order(1410..1412,1416..1424,1428..1442,1449..1454,
1461..1466,1479..1490)
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/note="nucleic acid binding region [nucleotide binding];
other site"
/db_xref="CDD:29002"
misc_feature 1431..1442
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/note="G-X-X-G motif; other site"
/db_xref="CDD:29002"
misc_feature 1548..1550
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q92945.4); phosphorylation site"
misc_feature 1821..2162
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q92945.4);
Region: 4 X 12 AA imperfect repeats"
misc_feature 2121..>2177
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/note="Domain of unknown function (DUF1897); Region:
DUF1897; pfam09005"
/db_xref="CDD:149918"
exon 360..456
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 457..495
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 496..535
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 536..585
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 586..657
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 658..715
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 716..890
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 891..989
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 990..1088
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 1089..1191
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
variation 1112
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/replace="c"
/replace="t"
/db_xref="dbSNP:2070198"
exon 1192..1292
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 1293..1437
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 1438..1598
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 1599..1708
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
variation 1704
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/replace="a"
/replace="c"
/db_xref="dbSNP:11546542"
exon 1709..1797
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 1798..1998
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 1999..2076
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 2077..2237
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
exon 2238..3254
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/inference="alignment:Splign:1.39.8"
STS 2255..3105
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/standard_name="KHSRP__1186"
/db_xref="UniSTS:277438"
STS 2311..2501
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/standard_name="STS-N79751"
/db_xref="UniSTS:67381"
variation 2516
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/replace="a"
/replace="c"
/db_xref="dbSNP:201433687"
variation 2643
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/replace="g"
/replace="t"
/db_xref="dbSNP:15383"
STS 2772..2892
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/standard_name="RH15912"
/db_xref="UniSTS:69289"
polyA_signal 2990..2995
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
polyA_site 3010
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
STS 3052..3204
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/standard_name="STS-N21621"
/db_xref="UniSTS:47197"
variation 3214
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
/replace="c"
/replace="t"
/db_xref="dbSNP:1654588"
polyA_signal 3230..3235
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
polyA_site 3254
/gene="KHSRP"
/gene_synonym="FBP2; FUBP2; KSRP"
ORIGIN
agagtgctccgcggccgtgtggagcgaggccttgttcccgcgttgagccgccgccgccgccgccgcctcctcagcttcagcctccgcgccaggcccggccccgccgcgccatgtcggactacagcacgggaggacccccgcccgggccgccgccgcccgccggcgggggcgggggagccggaggcgccgggggaggccctccgccgggcccgccaggcgcgggggaccggggcggcggcggtcccggcggcggcggcccgggcggggggtcggccgggggcccctctcagccacccggcggaggcggcccgggaatccgcaaggacgctttcgccgacgccgtgcagcgggcccgccagattgcagccaaaattggaggcgatgctgccacgacagtgaataacagcactcctgattttggttttgggggccaaaagagacagttggaagatggagatcaaccggagagcaagaagctggcttcccagggagactcaatcagttctcaacttggacccatccatcctcccccaaggacttcaatgacagaagagtacagggtcccagacggcatggtgggcctgatcattggcagaggaggtgaacaaattaacaaaatccaacaggattcaggctgcaaagtacagatttctccagacagcggtggcctacccgagcgcagtgtgtccttgacaggagccccagaatctgtccagaaagccaagatgatgctggatgacattgtgtctcggggtcgtgggggccccccaggacagttccacgacaacgccaacgggggccagaacggcaccgtgcaggagatcatgatccccgcgggcaaggccggcctggtcattggcaagggcggggagaccattaagcagctgcaggaacgcgctggagtgaagatgatcttaattcaggacggatctcagaatacgaatgtggacaaacctctccgcatcattggggatccttacaaagtgcagcaagcctgtgagatggtgatggacatcctccgggaacgtgaccaaggcggctttggggaccggaatgagtacggatctcggattggcggaggcatcgatgtgccagtgcccaggcattctgttggcgtggtcattggccggagtggagagatgatcaagaagatccagaatgatgctggcgtgcggatacagttcaagcaagatgacgggacagggcccgagaagattgctcatataatggggcccccagacaggtgcgagcacgcagcccggatcatcaacgacctcctccagagcctcaggagtggtcccccaggtcctccagggggtccaggcatgcccccggggggccgaggccgaggaagaggccaaggcaattggggtccccctggcggggagatgaccttctccatccccactcacaagtgtgggctggtcatcggccgaggtggcgagaatgtgaaagccataaaccagcagacgggagccttcgtagagatctcccggcagctgccacccaacggggaccccaacttcaagttgttcatcatccggggttcaccccagcagattgaccacgccaagcagcttatcgaggaaaagatcgagggtcctctctgcccagttggaccaggcccaggtggcccaggccctgctggcccaatggggcccttcaatcctgggcccttcaaccaggggccacccggggctcccccacatgccggggggccccctcctcaccagtacccaccccagggctggggcaatacctacccccagtggcagccgcctgctcctcatgacccaagcaaagcagctgcagcggccgcggaccccaacgccgcgtgggccgcctactactcacactactaccagcagcccccgggccccgtccccggccccgcaccggcccctgcggccccaccggctcagggtgagccccctcagcccccacccaccggccagtcggactacactaaggcctgggaagagtattacaaaaagatcggccagcagccccagcagcccggagcacccccacagcaggactacacgaaggcttgggaggagtactacaagaagcaagcgcaagtggccaccggagggggtccaggagctcccccaggctcccagccagactacagtgccgcctgggcggaatattacagacagcaggccgcttactacggacagaccccaggtcctggcggcccccagccgccgcccacgcagcagggacagcagcaggctcaatgaatcgaatgaatgtgaacttcttcatctgtgaaaaatcttttttttttccattttgttctgtttgggggcttctgttttgtttggcgagagagcgatggctgccgtggggagtactggggagccctcgcggcaagcagggtgggggggacttgggggcatgccgggccctcactctctcgcctgttctgtgtctcacatgctttttctttcaaaattgggatccttccatgttgagccagccagagaagatagcgagatctaaatctctgccaaaaaaaaaaaaaaacttaaaaattaaaaacacaaagagcaaagcagaacttataaaattatatatatatatattaaaaagtctctattcttcaccccccagccttcctgaacctgcctctctgaggataaagcaattcattttctcccaccctcggccctcttgtttttaaaataaacttttaaaaaggaaaaaaaaaagtcactcttgctatttcttttttttagttagaggtggaacattccttggaccaggtgttgtattgcaggaccccttcccccagcagccaagccccctcttctctccctcccgccctggctcagctcccgcggccccgcccgtcccccctcccaggactggtctgttgtcttttcatctgttcaagaggagattgaaactgaaaacaaaatgagaacaacaaaaaaaattgtatggcagtttttactttttatcgctcgtttttaacttcacaaataaatgataacaaaacctccccgtctgcgggtgctgtctgtctccccccctttccttccctccctgtagttttgaagcggatgtttgttctttatagatgttgtttaaaaagcctgataatggtgattgaaatttacaaactttgtgtttttttttttttaagaaaaatataaaatagttttcttcaggctcaatgtgctttcctaaccgtgccccccccccttttttttttttgttaaataaagtgctttttgtttaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:8570 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA
GeneID:8570 -> Molecular function: GO:0003723 [RNA binding] evidence: IEA
GeneID:8570 -> Biological process: GO:0000375 [RNA splicing, via transesterification reactions] evidence: TAS
GeneID:8570 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
GeneID:8570 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IEA
GeneID:8570 -> Biological process: GO:0006397 [mRNA processing] evidence: IEA
GeneID:8570 -> Biological process: GO:0008380 [RNA splicing] evidence: TAS
GeneID:8570 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:8570 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS
GeneID:8570 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS
GeneID:8570 -> Biological process: GO:0051028 [mRNA transport] evidence: IEA
GeneID:8570 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:8570 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:8570 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
GeneID:8570 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:8570 -> Cellular component: GO:0010494 [cytoplasmic stress granule] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.