2024-04-25 16:37:09, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_003685 3262 bp mRNA linear PRI 16-JUN-2013 DEFINITION Homo sapiens KH-type splicing regulatory protein (KHSRP), mRNA. ACCESSION NM_003685 VERSION NM_003685.2 GI:154354999 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 3262) AUTHORS Bhattacharyya,S., Kumar,P., Tsuchiya,M., Bhattacharyya,A. and Biswas,R. TITLE Regulation of miR-155 biogenesis in cystic fibrosis lung epithelial cells: antagonistic role of two mRNA-destabilizing proteins, KSRP and TTP JOURNAL Biochem. Biophys. Res. Commun. 433 (4), 484-488 (2013) PUBMED 23524258 REMARK GeneRIF: KSRP induces enhanced processing of pri- and pre-miR-155 in cystic fibrosis lung epithelial cells. REFERENCE 2 (bases 1 to 3262) AUTHORS Chen,L.L., Kung,Y.A., Weng,K.F., Lin,J.Y., Horng,J.T. and Shih,S.R. TITLE Enterovirus 71 infection cleaves a negative regulator for viral internal ribosomal entry site-driven translation JOURNAL J. Virol. 87 (7), 3828-3838 (2013) PUBMED 23345520 REMARK GeneRIF: Enterovirus 71 infection cleaved FBP2, which altered its function when its carboxyl terminus was cleaved. REFERENCE 3 (bases 1 to 3262) AUTHORS Nicastro,G., Garcia-Mayoral,M.F., Hollingworth,D., Kelly,G., Martin,S.R., Briata,P., Gherzi,R. and Ramos,A. TITLE Noncanonical G recognition mediates KSRP regulation of let-7 biogenesis JOURNAL Nat. Struct. Mol. Biol. 19 (12), 1282-1286 (2012) PUBMED 23142982 REMARK GeneRIF: Binding of the human KSRP protein to let-7 miRNA precursors positively regulates their processing to mature let-7, thereby contributing to control of cell proliferation, apoptosis and differentiation REFERENCE 4 (bases 1 to 3262) AUTHORS Otsuka,M., Takata,A., Yoshikawa,T., Kojima,K., Kishikawa,T., Shibata,C., Takekawa,M., Yoshida,H., Omata,M. and Koike,K. TITLE Receptor for activated protein kinase C: requirement for efficient microRNA function and reduced expression in hepatocellular carcinoma JOURNAL PLoS ONE 6 (9), E24359 (2011) PUBMED 21935400 REMARK GeneRIF: RACK1 binds to KH-type splicing regulatory protein (KSRP), a member of the Dicer complex, and is required for the recruitment of mature miRNAs to the RNA-induced silencing complex (RISC). REFERENCE 5 (bases 1 to 3262) AUTHORS Gherzi,R., Chen,C.Y., Trabucchi,M., Ramos,A. and Briata,P. TITLE The role of KSRP in mRNA decay and microRNA precursor maturation JOURNAL Wiley Interdiscip Rev RNA 1 (2), 230-239 (2010) PUBMED 21935887 REMARK GeneRIF: The role of KSRP in mRNA decay and microRNA precursor maturation. Review article REFERENCE 6 (bases 1 to 3262) AUTHORS Ring,H.Z., Vameghi-Meyers,V., Nikolic,J.M., Min,H., Black,D.L. and Francke,U. TITLE Mapping of the KHSRP gene to a region of conserved synteny on human chromosome 19p13.3 and mouse chromosome 17 JOURNAL Genomics 56 (3), 350-352 (1999) PUBMED 10087204 REFERENCE 7 (bases 1 to 3262) AUTHORS Chou,M.Y., Rooke,N., Turck,C.W. and Black,D.L. TITLE hnRNP H is a component of a splicing enhancer complex that activates a c-src alternative exon in neuronal cells JOURNAL Mol. Cell. Biol. 19 (1), 69-77 (1999) PUBMED 9858532 REFERENCE 8 (bases 1 to 3262) AUTHORS Min,H., Turck,C.W., Nikolic,J.M. and Black,D.L. TITLE A new regulatory protein, KSRP, mediates exon inclusion through an intronic splicing enhancer JOURNAL Genes Dev. 11 (8), 1023-1036 (1997) PUBMED 9136930 REFERENCE 9 (bases 1 to 3262) AUTHORS Davis-Smyth,T., Duncan,R.C., Zheng,T., Michelotti,G. and Levens,D. TITLE The far upstream element-binding proteins comprise an ancient family of single-strand DNA-binding transactivators JOURNAL J. Biol. Chem. 271 (49), 31679-31687 (1996) PUBMED 8940189 REFERENCE 10 (bases 1 to 3262) AUTHORS Dawson,S.J. and White,L.A. TITLE Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin JOURNAL J. Infect. 24 (3), 317-320 (1992) PUBMED 1602151 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DC388502.1, BC085004.1, CF123311.1, U94832.1, CB216491.1, BQ186683.1 and AA976482.1. On Aug 1, 2007 this sequence version replaced gi:4504864. Summary: The KHSRP gene encodes a multifunctional RNA-binding protein implicated in a variety of cellular processes, including transcription, alternative pre-mRNA splicing, and mRNA localization (Min et al., 1997 [PubMed 9136930]; Gherzi et al., 2004 [PubMed 15175153]).[supplied by OMIM, Apr 2010]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: U94832.1, U69126.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-36 DC388502.1 1-36 37-2023 BC085004.1 1-1987 2024-2187 CF123311.1 443-606 2188-2344 U94832.1 2171-2327 2345-2547 CB216491.1 431-633 2548-3010 U94832.1 2529-2991 3011-3223 BQ186683.1 448-660 3224-3262 AA976482.1 1-39 c FEATURES Location/Qualifiers source 1..3262 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="19" /map="19p13.3" gene 1..3262 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /note="KH-type splicing regulatory protein" /db_xref="GeneID:8570" /db_xref="HGNC:6316" /db_xref="MIM:603445" exon 1..359 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" CDS 111..2246 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /note="FUSE binding protein 2; p75; FUSE-binding protein 2; KH type-splicing regulatory protein" /codon_start=1 /product="far upstream element-binding protein 2" /protein_id="NP_003676.2" /db_xref="GI:154355000" /db_xref="CCDS:CCDS45936.1" /db_xref="GeneID:8570" /db_xref="HGNC:6316" /db_xref="MIM:603445" /translation="
MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNWGPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQLIEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPHDPSKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ
" misc_feature 408..410 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /experiment="experimental evidence, no additional details recorded" /note="Phosphothreonine; propagated from UniProtKB/Swiss-Prot (Q92945.4); phosphorylation site" misc_feature 546..734 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /note="K homology RNA-binding domain, type I. KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. There are two different KH domains that...; Region: KH-I; cd00105" /db_xref="CDD:29002" misc_feature order(570..572,576..584,588..602,609..614,621..626, 639..650) /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /note="nucleic acid binding region [nucleotide binding]; other site" /db_xref="CDD:29002" misc_feature 591..602 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /note="G-X-X-G motif; other site" /db_xref="CDD:29002" misc_feature 651..653 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (Q92945.4); phosphorylation site" misc_feature 687..689 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (Q92945.4); phosphorylation site" misc_feature 813..1010 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /note="K homology RNA-binding domain, type I. KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. There are two different KH domains that...; Region: KH-I; cd00105" /db_xref="CDD:29002" misc_feature order(837..839,843..851,855..869,876..881,888..893, 906..917) /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /note="nucleic acid binding region [nucleotide binding]; other site" /db_xref="CDD:29002" misc_feature 858..869 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /note="G-X-X-G motif; other site" /db_xref="CDD:29002" misc_feature 930..932 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (Q92945.4); phosphorylation site" misc_feature 1083..1268 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /note="K homology RNA-binding domain, type I. KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. There are two different KH domains that...; Region: KH-I; cd00105" /db_xref="CDD:29002" misc_feature order(1104..1106,1110..1118,1122..1136,1143..1148, 1155..1160,1173..1184) /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /note="nucleic acid binding region [nucleotide binding]; other site" /db_xref="CDD:29002" misc_feature 1125..1136 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /note="G-X-X-G motif; other site" /db_xref="CDD:29002" misc_feature 1386..1586 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /note="K homology RNA-binding domain, type I. KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. There are two different KH domains that...; Region: KH-I; cd00105" /db_xref="CDD:29002" misc_feature order(1410..1412,1416..1424,1428..1442,1449..1454, 1461..1466,1479..1490) /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /note="nucleic acid binding region [nucleotide binding]; other site" /db_xref="CDD:29002" misc_feature 1431..1442 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /note="G-X-X-G motif; other site" /db_xref="CDD:29002" misc_feature 1548..1550 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (Q92945.4); phosphorylation site" misc_feature 1821..2162 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q92945.4); Region: 4 X 12 AA imperfect repeats" misc_feature 2121..>2177 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /note="Domain of unknown function (DUF1897); Region: DUF1897; pfam09005" /db_xref="CDD:149918" exon 360..456 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 457..495 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 496..535 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 536..585 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 586..657 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 658..715 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 716..890 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 891..989 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 990..1088 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 1089..1191 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" variation 1112 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /replace="c" /replace="t" /db_xref="dbSNP:2070198" exon 1192..1292 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 1293..1437 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 1438..1598 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 1599..1708 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" variation 1704 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /replace="a" /replace="c" /db_xref="dbSNP:11546542" exon 1709..1797 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 1798..1998 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 1999..2076 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 2077..2237 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" exon 2238..3254 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /inference="alignment:Splign:1.39.8" STS 2255..3105 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /standard_name="KHSRP__1186" /db_xref="UniSTS:277438" STS 2311..2501 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /standard_name="STS-N79751" /db_xref="UniSTS:67381" variation 2516 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /replace="a" /replace="c" /db_xref="dbSNP:201433687" variation 2643 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /replace="g" /replace="t" /db_xref="dbSNP:15383" STS 2772..2892 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /standard_name="RH15912" /db_xref="UniSTS:69289" polyA_signal 2990..2995 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" polyA_site 3010 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" STS 3052..3204 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /standard_name="STS-N21621" /db_xref="UniSTS:47197" variation 3214 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" /replace="c" /replace="t" /db_xref="dbSNP:1654588" polyA_signal 3230..3235 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" polyA_site 3254 /gene="KHSRP" /gene_synonym="FBP2; FUBP2; KSRP" ORIGIN
agagtgctccgcggccgtgtggagcgaggccttgttcccgcgttgagccgccgccgccgccgccgcctcctcagcttcagcctccgcgccaggcccggccccgccgcgccatgtcggactacagcacgggaggacccccgcccgggccgccgccgcccgccggcgggggcgggggagccggaggcgccgggggaggccctccgccgggcccgccaggcgcgggggaccggggcggcggcggtcccggcggcggcggcccgggcggggggtcggccgggggcccctctcagccacccggcggaggcggcccgggaatccgcaaggacgctttcgccgacgccgtgcagcgggcccgccagattgcagccaaaattggaggcgatgctgccacgacagtgaataacagcactcctgattttggttttgggggccaaaagagacagttggaagatggagatcaaccggagagcaagaagctggcttcccagggagactcaatcagttctcaacttggacccatccatcctcccccaaggacttcaatgacagaagagtacagggtcccagacggcatggtgggcctgatcattggcagaggaggtgaacaaattaacaaaatccaacaggattcaggctgcaaagtacagatttctccagacagcggtggcctacccgagcgcagtgtgtccttgacaggagccccagaatctgtccagaaagccaagatgatgctggatgacattgtgtctcggggtcgtgggggccccccaggacagttccacgacaacgccaacgggggccagaacggcaccgtgcaggagatcatgatccccgcgggcaaggccggcctggtcattggcaagggcggggagaccattaagcagctgcaggaacgcgctggagtgaagatgatcttaattcaggacggatctcagaatacgaatgtggacaaacctctccgcatcattggggatccttacaaagtgcagcaagcctgtgagatggtgatggacatcctccgggaacgtgaccaaggcggctttggggaccggaatgagtacggatctcggattggcggaggcatcgatgtgccagtgcccaggcattctgttggcgtggtcattggccggagtggagagatgatcaagaagatccagaatgatgctggcgtgcggatacagttcaagcaagatgacgggacagggcccgagaagattgctcatataatggggcccccagacaggtgcgagcacgcagcccggatcatcaacgacctcctccagagcctcaggagtggtcccccaggtcctccagggggtccaggcatgcccccggggggccgaggccgaggaagaggccaaggcaattggggtccccctggcggggagatgaccttctccatccccactcacaagtgtgggctggtcatcggccgaggtggcgagaatgtgaaagccataaaccagcagacgggagccttcgtagagatctcccggcagctgccacccaacggggaccccaacttcaagttgttcatcatccggggttcaccccagcagattgaccacgccaagcagcttatcgaggaaaagatcgagggtcctctctgcccagttggaccaggcccaggtggcccaggccctgctggcccaatggggcccttcaatcctgggcccttcaaccaggggccacccggggctcccccacatgccggggggccccctcctcaccagtacccaccccagggctggggcaatacctacccccagtggcagccgcctgctcctcatgacccaagcaaagcagctgcagcggccgcggaccccaacgccgcgtgggccgcctactactcacactactaccagcagcccccgggccccgtccccggccccgcaccggcccctgcggccccaccggctcagggtgagccccctcagcccccacccaccggccagtcggactacactaaggcctgggaagagtattacaaaaagatcggccagcagccccagcagcccggagcacccccacagcaggactacacgaaggcttgggaggagtactacaagaagcaagcgcaagtggccaccggagggggtccaggagctcccccaggctcccagccagactacagtgccgcctgggcggaatattacagacagcaggccgcttactacggacagaccccaggtcctggcggcccccagccgccgcccacgcagcagggacagcagcaggctcaatgaatcgaatgaatgtgaacttcttcatctgtgaaaaatcttttttttttccattttgttctgtttgggggcttctgttttgtttggcgagagagcgatggctgccgtggggagtactggggagccctcgcggcaagcagggtgggggggacttgggggcatgccgggccctcactctctcgcctgttctgtgtctcacatgctttttctttcaaaattgggatccttccatgttgagccagccagagaagatagcgagatctaaatctctgccaaaaaaaaaaaaaaacttaaaaattaaaaacacaaagagcaaagcagaacttataaaattatatatatatatattaaaaagtctctattcttcaccccccagccttcctgaacctgcctctctgaggataaagcaattcattttctcccaccctcggccctcttgtttttaaaataaacttttaaaaaggaaaaaaaaaagtcactcttgctatttcttttttttagttagaggtggaacattccttggaccaggtgttgtattgcaggaccccttcccccagcagccaagccccctcttctctccctcccgccctggctcagctcccgcggccccgcccgtcccccctcccaggactggtctgttgtcttttcatctgttcaagaggagattgaaactgaaaacaaaatgagaacaacaaaaaaaattgtatggcagtttttactttttatcgctcgtttttaacttcacaaataaatgataacaaaacctccccgtctgcgggtgctgtctgtctccccccctttccttccctccctgtagttttgaagcggatgtttgttctttatagatgttgtttaaaaagcctgataatggtgattgaaatttacaaactttgtgtttttttttttttaagaaaaatataaaatagttttcttcaggctcaatgtgctttcctaaccgtgccccccccccttttttttttttgttaaataaagtgctttttgtttaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:8570 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA GeneID:8570 -> Molecular function: GO:0003723 [RNA binding] evidence: IEA GeneID:8570 -> Biological process: GO:0000375 [RNA splicing, via transesterification reactions] evidence: TAS GeneID:8570 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA GeneID:8570 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IEA GeneID:8570 -> Biological process: GO:0006397 [mRNA processing] evidence: IEA GeneID:8570 -> Biological process: GO:0008380 [RNA splicing] evidence: TAS GeneID:8570 -> Biological process: GO:0010467 [gene expression] evidence: TAS GeneID:8570 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS GeneID:8570 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS GeneID:8570 -> Biological process: GO:0051028 [mRNA transport] evidence: IEA GeneID:8570 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:8570 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS GeneID:8570 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA GeneID:8570 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:8570 -> Cellular component: GO:0010494 [cytoplasmic stress granule] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.