Home |
Help |
Advanced search
2024-04-25 00:12:39, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_003406 3003 bp mRNA linear PRI 01-JUL-2013
DEFINITION Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase
activation protein, zeta polypeptide (YWHAZ), transcript variant 1,
mRNA.
ACCESSION NM_003406
VERSION NM_003406.3 GI:208973235
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3003)
AUTHORS Riou,P., Kjaer,S., Garg,R., Purkiss,A., George,R., Cain,R.J.,
Bineva,G., Reymond,N., McColl,B., Thompson,A.J., O'Reilly,N.,
McDonald,N.Q., Parker,P.J. and Ridley,A.J.
TITLE 14-3-3 proteins interact with a hybrid prenyl-phosphorylation motif
to inhibit G proteins
JOURNAL Cell 153 (3), 640-653 (2013)
PUBMED 23622247
REMARK GeneRIF: Study reports a high-affinity 14-3-3-binding site at the C
terminus of Rnd3 consisting of both the Cys241-farnesyl moiety and
a Rho-associated coiled coil containing protein kinase
(ROCK)-dependent Ser240 phosphorylation site.
REFERENCE 2 (bases 1 to 3003)
AUTHORS Nishimura,Y., Komatsu,S., Ichikawa,D., Nagata,H., Hirajima,S.,
Takeshita,H., Kawaguchi,T., Arita,T., Konishi,H., Kashimoto,K.,
Shiozaki,A., Fujiwara,H., Okamoto,K., Tsuda,H. and Otsuji,E.
TITLE Overexpression of YWHAZ relates to tumor cell proliferation and
malignant outcome of gastric carcinoma
JOURNAL Br. J. Cancer 108 (6), 1324-1331 (2013)
PUBMED 23422756
REMARK GeneRIF: Overexpression of YWHAZ relates to tumor cell
proliferation and malignant outcome of gastric carcinoma.
REFERENCE 3 (bases 1 to 3003)
AUTHORS Bergamaschi,A., Frasor,J., Borgen,K., Stanculescu,A., Johnson,P.,
Rowland,K., Wiley,E.L. and Katzenellenbogen,B.S.
TITLE 14-3-3zeta as a predictor of early time to recurrence and distant
metastasis in hormone receptor-positive and -negative breast
cancers
JOURNAL Breast Cancer Res. Treat. 137 (3), 689-696 (2013)
PUBMED 23271328
REMARK GeneRIF: 14-3-3zeta as a predictor of early time to recurrence and
distant metastasis in hormone receptor-positive and -negative
breast cancers.
REFERENCE 4 (bases 1 to 3003)
AUTHORS Boon,S.S. and Banks,L.
TITLE High-risk human papillomavirus E6 oncoproteins interact with
14-3-3zeta in a PDZ binding motif-dependent manner
JOURNAL J. Virol. 87 (3), 1586-1595 (2013)
PUBMED 23175360
REMARK GeneRIF: The interaction is direct and specific for the high-risk
HPV E6 oncoproteins, although there are significant differences in
the efficiencies with which HPV-16, HPV-18, and HPV-31 E6
oncoproteins can associate with 14-3-3zeta.
REFERENCE 5 (bases 1 to 3003)
AUTHORS Skwarczynska,M., Molzan,M. and Ottmann,C.
TITLE Activation of NF-kappaB signalling by fusicoccin-induced
dimerization
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 110 (5), E377-E386 (2013)
PUBMED 23269842
REMARK GeneRIF: Data indicate that fusicoccin (FC)-mediated dimerization
of the NF-kappaB-C terminus(CT) with a constitutively
nuclear-localized 14-3-3 protein led to an NF-kappaB-specific
cellular response by inducing IL-8 secretion.
REFERENCE 6 (bases 1 to 3003)
AUTHORS Koyama,S., Williams,L.T. and Kikuchi,A.
TITLE Characterization of the interaction of Raf-1 with ras p21 or 14-3-3
protein in intact cells
JOURNAL FEBS Lett. 368 (2), 321-325 (1995)
PUBMED 7628630
REFERENCE 7 (bases 1 to 3003)
AUTHORS Liu,D., Bienkowska,J., Petosa,C., Collier,R.J., Fu,H. and
Liddington,R.
TITLE Crystal structure of the zeta isoform of the 14-3-3 protein
JOURNAL Nature 376 (6536), 191-194 (1995)
PUBMED 7603574
REFERENCE 8 (bases 1 to 3003)
AUTHORS Sato,T., Irie,S., Kitada,S. and Reed,J.C.
TITLE FAP-1: a protein tyrosine phosphatase that associates with Fas
JOURNAL Science 268 (5209), 411-415 (1995)
PUBMED 7536343
REFERENCE 9 (bases 1 to 3003)
AUTHORS Kawamoto,S., Shoji,M., Setoguchi,Y., Kato,M., Hashizume,S.,
Ichikawa,A., Osada,K., Katakura,Y., Tachibana,H. and Murakami,H.
TITLE Molecular cloning of the 31 kDa cytosolic phospholipase A2, as an
antigen recognized by the lung cancer-specific human monoclonal
antibody, AE6F4
JOURNAL Cytotechnology 17 (2), 103-108 (1995)
PUBMED 7547034
REFERENCE 10 (bases 1 to 3003)
AUTHORS Zupan,L.A., Steffens,D.L., Berry,C.A., Landt,M. and Gross,R.W.
TITLE Cloning and expression of a human 14-3-3 protein mediating
phospholipolysis. Identification of an arachidonoyl-enzyme
intermediate during catalysis
JOURNAL J. Biol. Chem. 267 (13), 8707-8710 (1992)
PUBMED 1577711
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DC298291.1, BC072426.1 and
BM783874.1.
On Oct 8, 2008 this sequence version replaced gi:21735623.
Summary: This gene product belongs to the 14-3-3 family of proteins
which mediate signal transduction by binding to
phosphoserine-containing proteins. This highly conserved protein
family is found in both plants and mammals, and this protein is 99%
identical to the mouse, rat and sheep orthologs. The encoded
protein interacts with IRS1 protein, suggesting a role in
regulating insulin sensitivity. Several transcript variants that
differ in the 5' UTR but that encode the same protein have been
identified for this gene. [provided by RefSeq, Oct 2008].
Transcript Variant: This variant (1) differs in the 5' UTR compared
to variant 2. All six transcripts encode the same protein.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: M86400.1, AL514198.3 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025088 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-127 DC298291.1 1-127
128-2886 BC072426.1 97-2855
2887-3003 BM783874.1 221-337
FEATURES Location/Qualifiers
source 1..3003
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="8"
/map="8q23.1"
gene 1..3003
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/note="tyrosine 3-monooxygenase/tryptophan 5-monooxygenase
activation protein, zeta polypeptide"
/db_xref="GeneID:7534"
/db_xref="HGNC:12855"
/db_xref="HPRD:03183"
/db_xref="MIM:601288"
exon 1..127
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/inference="alignment:Splign:1.39.8"
misc_feature 121..123
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/note="upstream in-frame stop codon"
exon 128..432
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/inference="alignment:Splign:1.39.8"
CDS 139..876
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/note="14-3-3 delta; tyrosine 3-monooxygenase/tryptophan
5-monooxygenase activation protein, delta polypeptide;
14-3-3 zeta; phospholipase A2; protein kinase C inhibitor
protein-1; tyrosine 3/tryptophan 5 -monooxygenase
activation protein, zeta polypeptide; 14-3-3
protein/cytosolic phospholipase A2; protein kinase C
inhibitor protein 1"
/codon_start=1
/product="14-3-3 protein zeta/delta"
/protein_id="NP_003397.1"
/db_xref="GI:4507953"
/db_xref="CCDS:CCDS6290.1"
/db_xref="GeneID:7534"
/db_xref="HGNC:12855"
/db_xref="HPRD:03183"
/db_xref="MIM:601288"
/translation="
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
"
misc_feature 139..141
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="N-acetylmethionine; propagated from
UniProtKB/Swiss-Prot (P63104.1); acetylation site"
misc_feature 142..828
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/note="14-3-3 beta and zeta isoforms of 14-3-3 protein;
Region: 14-3-3_beta_zeta; cd10022"
/db_xref="CDD:206758"
misc_feature 145..147
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P63104.1); acetylation site"
misc_feature order(151..153,160..165,172..177,181..186,190..192,
199..201,310..312,319..321,331..333,361..363,370..375,
382..384,391..396,403..405)
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/note="dimer interface [polypeptide binding]; other site"
/db_xref="CDD:206758"
misc_feature 211..213
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="S-nitrosylation site; modified site"
misc_feature order(259..264,271..276,283..285,487..489,496..498,
517..522,631..633,643..645,652..657,664..666,763..777,
784..789,796..798,808..810)
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/note="peptide binding site [polypeptide binding]; other
site"
/db_xref="CDD:206758"
misc_feature 304..306
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/inference="non-experimental evidence, no additional
details recorded"
/note="Interaction with phosphoserine on interacting
protein (By similarity); propagated from
UniProtKB/Swiss-Prot (P63104.1); other site"
misc_feature 310..312
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by PKA and PKB/AKT1; propagated from
UniProtKB/Swiss-Prot (P63104.1); phosphorylation site"
misc_feature 310..312
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:11882"
misc_feature 310..312
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01501"
misc_feature 310..312
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01261"
misc_feature 310..312
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03770"
misc_feature 310..312
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 340..342
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P63104.1); acetylation site"
misc_feature 517..519
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/inference="non-experimental evidence, no additional
details recorded"
/note="Interaction with phosphoserine on interacting
protein (By similarity); propagated from
UniProtKB/Swiss-Prot (P63104.1); other site"
misc_feature 688..690
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by MAPK8; propagated from
UniProtKB/Swiss-Prot (P63104.1); phosphorylation site"
misc_feature 688..690
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01261"
misc_feature 688..690
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03100"
misc_feature 757..759
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P63104.1); phosphorylation site"
misc_feature 832..834
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine, by CK1; propagated from
UniProtKB/Swiss-Prot (P63104.1); phosphorylation site"
misc_feature 832..834
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:02739"
STS 339..582
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/standard_name="PMC150726P7"
/db_xref="UniSTS:271079"
variation 365
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/replace="a"
/replace="g"
/db_xref="dbSNP:11551365"
variation 399
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/replace="a"
/replace="g"
/db_xref="dbSNP:41473144"
exon 433..556
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/inference="alignment:Splign:1.39.8"
exon 557..720
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/inference="alignment:Splign:1.39.8"
exon 721..816
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/inference="alignment:Splign:1.39.8"
exon 817..2993
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/inference="alignment:Splign:1.39.8"
variation 962
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/replace="g"
/replace="t"
/db_xref="dbSNP:11551354"
STS 1145..1238
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/standard_name="PMC126239P3"
/db_xref="UniSTS:270535"
variation 1234
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/replace="g"
/replace="t"
/db_xref="dbSNP:11551357"
STS 1264..2012
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/standard_name="YWHAZ_1120.2"
/db_xref="UniSTS:281082"
variation 1343
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/replace="c"
/replace="t"
/db_xref="dbSNP:11545396"
polyA_signal 1849..1854
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
polyA_site 1880
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
variation 2363
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/replace="c"
/replace="t"
/db_xref="dbSNP:11551356"
variation 2648
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/replace="c"
/replace="g"
/db_xref="dbSNP:1062376"
variation 2668
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/replace="a"
/replace="c"
/db_xref="dbSNP:1062382"
variation 2794
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/replace="c"
/replace="t"
/db_xref="dbSNP:1139382"
variation 2810
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/replace="a"
/replace="c"
/db_xref="dbSNP:1062393"
polyA_signal 2823..2828
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
polyA_site 2846
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
polyA_site 2886
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
variation 2888
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
/replace="a"
/replace="c"
/db_xref="dbSNP:3203463"
polyA_signal 2975..2980
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
polyA_site 2993
/gene="YWHAZ"
/gene_synonym="14-3-3-zeta; KCIP-1; YWHAD"
ORIGIN
ctttctccttccccttcttccgggctcccgtcccggctcatcacccggcctgtggcccactcccaccgccagctggaaccctggggactacgacgtccctcaaaccttgcttctaggagataaaaagaacatccagtcatggataaaaatgagctggttcagaaggccaaactggccgagcaggctgagcgatatgatgacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggagaggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagggtcgtctcaagtattgaacaaaagacggaaggtgctgagaaaaaacagcagatggctcgagaatacagagagaaaattgagacggagctaagagatatctgcaatgatgtactgtctcttttggaaaagttcttgatccccaatgcttcacaagcagagagcaaagtcttctatttgaaaatgaaaggagattactaccgttacttggctgaggttgccgctggtgatgacaagaaagggattgtcgatcagtcacaacaagcataccaagaagcttttgaaatcagcaaaaaggaaatgcaaccaacacatcctatcagactgggtctggcccttaacttctctgtgttctattatgagattctgaactccccagagaaagcctgctctcttgcaaagacagcttttgatgaagccattgctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcaattactgagagacaacttgacattgtggacatcggatacccaaggagacgaagctgaagcaggagaaggaggggaaaattaaccggccttccaacttttgtctgcctcattctaaaatttacacagtagaccatttgtcatccatgctgtcccacaaatagttttttgtttacgatttatgacaggtttatgttacttctatttgaatttctatatttcccatgtggtttttatgtttaatattaggggagtagagccagttaacatttagggagttatctgttttcatcttgaggtggccaatatggggatgtggaatttttatacaagttataagtgtttggcatagtacttttggtacattgtggcttcaaaagggccagtgtaaaactgcttccatgtctaagcaaagaaaactgcctacatactggtttgtcctggcggggaataaaagggatcattggttccagtcacaggtgtagtaattgtgggtactttaaggtttggagcacttacaaggctgtggtagaatcataccccatggataccacatattaaaccatgtatatctgtggaatactcaatgtgtacacctttgactacagctgcagaagtgttcctttagacaaagttgtgacccattttactctggataagggcagaaacggttcacattccattatttgtaaagttacctgctgttagctttcattatttttgctacactcattttatttgtatttaaatgttttaggcaacctaagaacaaatgtaaaagtaaagatgcaggaaaaatgaattgcttggtattcattacttcatgtatatcaagcacagcagtaaaacaaaaacccatgtatttaacttttttttaggatttttgcttttgtgatttttttttttttgatacttgcctaacatgcatgtgctgtaaaaatagttaacagggaaataacttgagatgatggctagctttgtttaatgtcttatgaaattttcatgaacaatccaagcataattgttaagaacacgtgtattaaattcatgtaagtggaataaaagttttatgaatggacttttcaactactttctctacagcttttcatgtaaattagtcttggttctgaaacttctctaaaggaaattgtacattttttgaaatttattccttattccctcttggcagctaatgggctcttaccaagtttaaacacaaaatttatcataacaaaaatactactaatataactactgtttccatgtcccatgatcccctctcttcctccccaccctgaaaaaaatgagttcctattttttctgggagagggggggattgattagaaaaaaatgtagtgtgttccatttaaaattttggcatatggcattttctaacttaggaagccacaatgttcttggcccatcatgacattgggtagcattaactgtaagttttgtgcttccaaatcactttttggtttttaagaatttcttgatactcttatagcctgccttcaattttgatcctttattctttctatttgtcaggtgcacaagattaccttcctgttttagccttctgtcttgtcaccaaccattcttacttggtggccatgtacttggaaaaaggccgcatgatctttctggctccactcagtgtctaaggcaccctgcttcctttgcttgcatcccacagactatttccctcatcctatttactgcagcaaatctctccttagttgatgagactgtgtttatctccctttaaaaccctacctatcctgaatggtctgtcattgtctgcctttaaaatccttcctctttcttcctcctctattctctaaataatgatggggctaagttatacccaaagctcactttacaaaatatttcctcagtactttgcagaaaacaccaaacaaaaatgccattttaaaaaaggtgtattttttcttttagaatgtaagctcctcaagagcagggacaatgttttctgtatgttctattgtgcctagtacactgtaaatgctcaataaatattgatgatgggaggcagtgagtcttgatgataagggtgagaaactgaaatcccaaacactgttttgttgcttgttttattatgacctcagattaaattgggaaatattggcccttttgaataattgtcccaaatattacattcaaataaaagtgcaatggagaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:7534 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:7534 -> Molecular function: GO:0008134 [transcription factor binding] evidence: IPI
GeneID:7534 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI
GeneID:7534 -> Molecular function: GO:0019904 [protein domain specific binding] evidence: IEA
GeneID:7534 -> Molecular function: GO:0032403 [protein complex binding] evidence: IEA
GeneID:7534 -> Biological process: GO:0002553 [histamine secretion by mast cell] evidence: IEA
GeneID:7534 -> Biological process: GO:0006626 [protein targeting to mitochondrion] evidence: IEA
GeneID:7534 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:7534 -> Biological process: GO:0007165 [signal transduction] evidence: TAS
GeneID:7534 -> Biological process: GO:0007596 [blood coagulation] evidence: TAS
GeneID:7534 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:7534 -> Biological process: GO:0016044 [cellular membrane organization] evidence: TAS
GeneID:7534 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS
GeneID:7534 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS
GeneID:7534 -> Biological process: GO:0030168 [platelet activation] evidence: TAS
GeneID:7534 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:7534 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS
GeneID:7534 -> Biological process: GO:1900740 [positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: TAS
GeneID:7534 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:7534 -> Cellular component: GO:0005737 [cytoplasm] evidence: TAS
GeneID:7534 -> Cellular component: GO:0005739 [mitochondrion] evidence: IEA
GeneID:7534 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:7534 -> Cellular component: GO:0014069 [postsynaptic density] evidence: IEA
GeneID:7534 -> Cellular component: GO:0030659 [cytoplasmic vesicle membrane] evidence: TAS
GeneID:7534 -> Cellular component: GO:0031252 [cell leading edge] evidence: IEA
GeneID:7534 -> Cellular component: GO:0042470 [melanosome] evidence: IEA
GeneID:7534 -> Cellular component: GO:0043234 [protein complex] evidence: IEA
GeneID:7534 -> Cellular component: GO:0048471 [perinuclear region of cytoplasm] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.