Home |
Help |
Advanced search
2024-04-25 11:26:57, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_003405 1807 bp mRNA linear PRI 24-JUN-2013
DEFINITION Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase
activation protein, eta polypeptide (YWHAH), mRNA.
ACCESSION NM_003405
VERSION NM_003405.3 GI:61744461
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1807)
AUTHORS Lee,C.G., Park,G.Y., Han,Y.K., Lee,J.H., Chun,S.H., Park,H.Y.,
Lim,K.H., Kim,E.G., Choi,Y.J., Yang,K. and Lee,C.W.
TITLE Roles of 14-3-3eta in mitotic progression and its potential use as
a therapeutic target for cancers
JOURNAL Oncogene 32 (12), 1560-1569 (2013)
PUBMED 22562251
REMARK GeneRIF: 14-3-3eta may be required for mitotic progression and may
be considered as a novel anti-cancer strategy in combination with
microtubule inhibitors.
REFERENCE 2 (bases 1 to 1807)
AUTHORS Yun,J., Jeong,B.H., Kim,H.J., Park,Y.J., Lee,Y.J., Choi,E.K.,
Carp,R.I. and Kim,Y.S.
TITLE A polymorphism in the YWHAH gene encoding 14-3-3 eta that is not
associated with sporadic Creutzfeldt-Jakob disease (CJD)
JOURNAL Mol. Biol. Rep. 39 (4), 3619-3625 (2012)
PUBMED 21739144
REMARK GeneRIF: This is the first genetic association study of YWHAH with
sporadic Creutzfeldt-Jakob disease populations.
REFERENCE 3 (bases 1 to 1807)
AUTHORS Carr,M., Chavez-Munoz,C., Lai,A. and Ghahary,A.
TITLE Dermal fibroblasts influence the expression profile of 14-3-3
proteins in human keratinocytes
JOURNAL Mol. Cell. Biochem. 353 (1-2), 205-214 (2011)
PUBMED 21416292
REMARK GeneRIF: Data indicate that gene analysis revealed an up-regulation
of all four 14-3-3 isoforms beta, eta, gamma, and sigma.
REFERENCE 4 (bases 1 to 1807)
AUTHORS Li,X.H., Noguchi,A., Nishida,T., Takahashi,H., Zheng,Y., Yang,X.H.,
Masuda,S., Kikuchi,K. and Takano,Y.
TITLE Cytoplasmic expression of p33ING1b is correlated with tumorigenesis
and progression of head and neck squamous cell carcinoma
JOURNAL Histol. Histopathol. 26 (5), 597-607 (2011)
PUBMED 21432775
REMARK GeneRIF: relocation of p33ING1b from the nucleus to the cytoplasm,
where the protein is tethered by 14-3-3eta, participates in
tumorigenesis and progression in HNSCC
REFERENCE 5 (bases 1 to 1807)
AUTHORS Liu,Y., Tian,R.F., Li,Y.M., Liu,W.P., Cao,L., Yang,X.L., Cao,W.D.
and Zhang,X.
TITLE The expression of seven 14-3-3 isoforms in human meningioma
JOURNAL Brain Res. 1336, 98-102 (2010)
PUBMED 20388496
REMARK GeneRIF: The 14-3-3 eta, beta, gamma and sigma isoforms were
negatively expressed in meningioma
REFERENCE 6 (bases 1 to 1807)
AUTHORS Ichimura,T., Uchiyama,J., Kunihiro,O., Ito,M., Horigome,T.,
Omata,S., Shinkai,F., Kaji,H. and Isobe,T.
TITLE Identification of the site of interaction of the 14-3-3 protein
with phosphorylated tryptophan hydroxylase
JOURNAL J. Biol. Chem. 270 (48), 28515-28518 (1995)
PUBMED 7499362
REFERENCE 7 (bases 1 to 1807)
AUTHORS Jones,D.H., Ley,S. and Aitken,A.
TITLE Isoforms of 14-3-3 protein can form homo- and heterodimers in vivo
and in vitro: implications for function as adapter proteins
JOURNAL FEBS Lett. 368 (1), 55-58 (1995)
PUBMED 7615088
REFERENCE 8 (bases 1 to 1807)
AUTHORS Wu,C., Friedlander,P., Lamoureux,C., Zannis-Hadjopoulos,M. and
Price,G.B.
TITLE cDNA clones contain autonomous replication activity
JOURNAL Biochim. Biophys. Acta 1174 (3), 241-257 (1993)
PUBMED 7690594
REFERENCE 9 (bases 1 to 1807)
AUTHORS Ichimura-Ohshima,Y., Morii,K., Ichimura,T., Araki,K., Takahashi,Y.,
Isobe,T., Minoshima,S., Fukuyama,R., Shimizu,N. and Kuwano,R.
TITLE cDNA cloning and chromosome assignment of the gene for human brain
14-3-3 protein eta chain
JOURNAL J. Neurosci. Res. 31 (4), 600-605 (1992)
PUBMED 1578511
REFERENCE 10 (bases 1 to 1807)
AUTHORS Ichimura,T., Isobe,T., Okuyama,T., Takahashi,N., Araki,K.,
Kuwano,R. and Takahashi,Y.
TITLE Molecular cloning of cDNA coding for brain-specific 14-3-3 protein,
a protein kinase-dependent activator of tyrosine and tryptophan
hydroxylases
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 85 (19), 7084-7088 (1988)
PUBMED 2902623
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from Z82248.1, BC003047.1 and
AY007132.1.
On Mar 24, 2005 this sequence version replaced gi:21464102.
Summary: This gene product belongs to the 14-3-3 family of proteins
which mediate signal transduction by binding to
phosphoserine-containing proteins. This highly conserved protein
family is found in both plants and mammals, and this protein is 99%
identical to the mouse, rat and bovine orthologs. This gene
contains a 7 bp repeat sequence in its 5' UTR, and changes in the
number of this repeat have been associated with early-onset
schizophrenia and psychotic bipolar disorder. [provided by RefSeq,
Jun 2009].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC003047.1, S80794.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-112 Z82248.1 24178-24289
113-413 BC003047.1 48-348
414-1807 AY007132.1 1-1394
FEATURES Location/Qualifiers
source 1..1807
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="22"
/map="22q12.3"
gene 1..1807
/gene="YWHAH"
/gene_synonym="YWHA1"
/note="tyrosine 3-monooxygenase/tryptophan 5-monooxygenase
activation protein, eta polypeptide"
/db_xref="GeneID:7533"
/db_xref="HGNC:12853"
/db_xref="HPRD:00215"
/db_xref="MIM:113508"
exon 1..328
/gene="YWHAH"
/gene_synonym="YWHA1"
/inference="alignment:Splign:1.39.8"
variation 88..94
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace=""
/replace="gcctgca"
/db_xref="dbSNP:71697452"
variation 106..112
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace=""
/replace="gcagcct"
/db_xref="dbSNP:80248435"
variation 106
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace=""
/replace="gcagcct"
/db_xref="dbSNP:71184535"
variation 149
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:184614680"
variation 181
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:11539380"
misc_feature 209..211
/gene="YWHAH"
/gene_synonym="YWHA1"
/note="upstream in-frame stop codon"
variation 220
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="g"
/replace="t"
/db_xref="dbSNP:11539379"
CDS 242..982
/gene="YWHAH"
/gene_synonym="YWHA1"
/note="14-3-3 eta"
/codon_start=1
/product="14-3-3 protein eta"
/protein_id="NP_003396.1"
/db_xref="GI:4507951"
/db_xref="CCDS:CCDS13901.1"
/db_xref="GeneID:7533"
/db_xref="HGNC:12853"
/db_xref="HPRD:00215"
/db_xref="MIM:113508"
/translation="
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
"
misc_feature 245..247
/gene="YWHAH"
/gene_synonym="YWHA1"
/experiment="experimental evidence, no additional details
recorded"
/note="N-acetylglycine; propagated from
UniProtKB/Swiss-Prot (Q04917.4); acetylation site"
misc_feature 245..247
/gene="YWHAH"
/gene_synonym="YWHA1"
/experiment="experimental evidence, no additional details
recorded"
/note="acetylation site"
misc_feature 248..964
/gene="YWHAH"
/gene_synonym="YWHA1"
/note="14-3-3 eta, an isoform of 14-3-3 protein; Region:
14-3-3_eta; cd10025"
/db_xref="CDD:206761"
misc_feature order(269..271,278..283,287..292,296..298,305..307,
416..418,425..430,437..439,494..496,503..508,515..517)
/gene="YWHAH"
/gene_synonym="YWHA1"
/note="dimer interface [polypeptide binding]; other site"
/db_xref="CDD:206761"
misc_feature 314..316
/gene="YWHAH"
/gene_synonym="YWHA1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q04917.4); phosphorylation site"
misc_feature order(389..391,410..412,635..640,770..775,782..784,
905..907,914..916,926..928)
/gene="YWHAH"
/gene_synonym="YWHA1"
/note="peptide binding site [polypeptide binding]; other
site"
/db_xref="CDD:206761"
misc_feature 410..412
/gene="YWHAH"
/gene_synonym="YWHA1"
/experiment="experimental evidence, no additional details
recorded"
/note="Interaction with phosphoserine on interacting
protein; propagated from UniProtKB/Swiss-Prot (Q04917.4);
other site"
misc_feature 416..418
/gene="YWHAH"
/gene_synonym="YWHA1"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 635..637
/gene="YWHAH"
/gene_synonym="YWHA1"
/experiment="experimental evidence, no additional details
recorded"
/note="Interaction with phosphoserine on interacting
protein; propagated from UniProtKB/Swiss-Prot (Q04917.4);
other site"
exon 329..1793
/gene="YWHAH"
/gene_synonym="YWHA1"
/inference="alignment:Splign:1.39.8"
variation 357
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:148198776"
variation 367
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="c"
/db_xref="dbSNP:376719456"
STS 374..624
/gene="YWHAH"
/gene_synonym="YWHA1"
/standard_name="REN75940"
/db_xref="UniSTS:400740"
variation 418
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="g"
/db_xref="dbSNP:61752252"
variation 432
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:371520759"
variation 447
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:200741786"
variation 484
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:201984741"
variation 571
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="g"
/replace="t"
/db_xref="dbSNP:11539378"
STS 614..1455
/gene="YWHAH"
/gene_synonym="YWHA1"
/standard_name="YWHAH_1118"
/db_xref="UniSTS:277871"
STS 618..875
/gene="YWHAH"
/gene_synonym="YWHA1"
/standard_name="REN75941"
/db_xref="UniSTS:400741"
variation 657
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="g"
/db_xref="dbSNP:150273100"
variation 668
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace=""
/replace="a"
/db_xref="dbSNP:145603750"
variation 670
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:78051162"
variation 745
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:8192635"
variation 752
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:367752222"
STS 796..1556
/gene="YWHAH"
/gene_synonym="YWHA1"
/standard_name="ECD04571"
/db_xref="UniSTS:285643"
STS 861..1119
/gene="YWHAH"
/gene_synonym="YWHA1"
/standard_name="REN75942"
/db_xref="UniSTS:400742"
variation 865
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:113715410"
variation 885
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:75617813"
variation 901
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:35621275"
variation 914
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:369393668"
variation 942
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:201532069"
variation 946
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:377641891"
variation 964
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:139643031"
variation 985
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:78386008"
variation 994
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:1049583"
variation 999
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="g"
/db_xref="dbSNP:80295425"
variation 1001
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:2858755"
variation 1006
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="g"
/replace="t"
/db_xref="dbSNP:373594195"
variation 1007
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:376992185"
variation 1012
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:370005433"
variation 1026
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="t"
/db_xref="dbSNP:372639562"
STS 1117..1363
/gene="YWHAH"
/gene_synonym="YWHA1"
/standard_name="REN75943"
/db_xref="UniSTS:400743"
STS 1145..1362
/gene="YWHAH"
/gene_synonym="YWHA1"
/standard_name="RH18134"
/db_xref="UniSTS:28361"
STS 1339..1568
/gene="YWHAH"
/gene_synonym="YWHA1"
/standard_name="REN75944"
/db_xref="UniSTS:400744"
variation 1350
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="g"
/replace="t"
/db_xref="dbSNP:186550345"
variation 1380
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:192602237"
variation 1492
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:370416947"
variation 1513
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:185384904"
STS 1532..1681
/gene="YWHAH"
/gene_synonym="YWHA1"
/standard_name="SHGC-4185"
/db_xref="UniSTS:39278"
variation 1541
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:148616662"
STS 1557..1778
/gene="YWHAH"
/gene_synonym="YWHA1"
/standard_name="GDB:452620"
/db_xref="UniSTS:157394"
variation 1585
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:115884522"
variation 1594..1595
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace=""
/replace="t"
/db_xref="dbSNP:34145379"
variation 1601..1602
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace=""
/replace="t"
/replace="tt"
/db_xref="dbSNP:71697808"
variation 1608
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="g"
/replace="t"
/db_xref="dbSNP:77289669"
variation 1608
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace=""
/replace="t"
/db_xref="dbSNP:71790951"
variation 1610
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="g"
/replace="t"
/db_xref="dbSNP:62240587"
variation 1611
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="g"
/replace="t"
/db_xref="dbSNP:1049816"
STS 1641..1777
/gene="YWHAH"
/gene_synonym="YWHA1"
/standard_name="WI-15366"
/db_xref="UniSTS:48152"
variation 1680
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="a"
/replace="c"
/db_xref="dbSNP:142094943"
variation 1696..1697
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace=""
/replace="c"
/db_xref="dbSNP:34122600"
variation 1738
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:1049865"
variation 1763
/gene="YWHAH"
/gene_synonym="YWHA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:188688583"
polyA_signal 1769..1774
/gene="YWHAH"
/gene_synonym="YWHA1"
polyA_site 1793
/gene="YWHAH"
/gene_synonym="YWHA1"
ORIGIN
gcggccgcgtctcctccctcggcgttgtccgcggcgcgagccacagcgcgcggggcgagccagcgagagggcgcgagcggcggcgctgcctgcagcctgcagcctgcagcctccggccggccggcgagccagtgcgcgtgcgcggcggcggcctccgcagcgaccggggagcggactgaccggcgggagggctagcgagccagcggtgtgaggcgcgaggcgaggccgagccgcgagcgacatgggggaccgggagcagctgctgcagcgggcgcggctggccgagcaggcggagcgctacgacgacatggcctccgctatgaaggcggtgacagagctgaatgaacctctctccaatgaagatcgaaatctcctctctgtggcctacaagaatgtggttggtgccaggcgatcttcctggagggtcattagcagcattgagcagaaaaccatggctgatggaaacgaaaagaaattggagaaagttaaagcttaccgggagaagattgagaaggagctggagacagtttgcaatgatgtcctgtctctgcttgacaagttcctgatcaagaactgcaatgatttccagtatgagagcaaggtgttttacctgaaaatgaagggtgattactaccgctacttagcagaggtcgcttctggggagaagaaaaacagtgtggtcgaagcttctgaagctgcctacaaggaagcctttgaaatcagcaaagagcagatgcaacccacgcatcccatccggctgggcctggccctcaacttctccgtgttctactatgagatccagaatgcacctgagcaagcctgcctcttagccaaacaagccttcgatgatgccatagctgagctggacacactaaacgaggattcctataaggactccacgctgatcatgcagttgctgcgagacaacctcaccctctggacgagcgaccagcaggatgaagaagcaggagaaggcaactgaagatccttcaggtcccctggcccttccttcacccaccacccccatcatcaccgattcttccttgccacaatcactaaatatctagtgctaaacctatctgtattggcagcacagctactcagatctgcactcctgtctcttgggaagcagtttcagataaatcatgggcattgctggactgatggttgctttgagcccacaggagctccctttttgaattgtgtggagaagtgtgttctgatgaggcattttactatgcctgttgatctatgggaaatctaggcgaaagtaatggggaagattagaaagaattagccaaccaggctacagttgatatttaaaagatccatttaaaacaagctgatagtgtttcgttaagcagtacatcttgtgcatgcaaaaatgaattcacccctcccacctctttcttcaattaatggaaaactgttaagggaagctgatacagagagacaacttgctcctttccatcagctttataataaactgtttaacgtgaggtttcagtagctccttggttttgcctctttaaattatgacgtgcacaaaccttcttttcaatgcaatgcatctgaaagttttgatacttgtaacttttttttttttttggttgcaattgtttaagaatcatggatttattttttgtaactctttggctattgtccttgtgtatcctgacagcgccatgtgtgtcagcccatgtcaatcaagatgggtgattatgaaatgccagacttctaaaataaatgttttggaattcaatgggtaaataaatgctgctttggggatattaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:7533 -> Molecular function: GO:0003779 [actin binding] evidence: IEA
GeneID:7533 -> Molecular function: GO:0005159 [insulin-like growth factor receptor binding] evidence: ISS
GeneID:7533 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:7533 -> Molecular function: GO:0017080 [sodium channel regulator activity] evidence: ISS
GeneID:7533 -> Molecular function: GO:0019899 [enzyme binding] evidence: IPI
GeneID:7533 -> Molecular function: GO:0019904 [protein domain specific binding] evidence: ISS
GeneID:7533 -> Molecular function: GO:0035259 [glucocorticoid receptor binding] evidence: IPI
GeneID:7533 -> Molecular function: GO:0044325 [ion channel binding] evidence: ISS
GeneID:7533 -> Biological process: GO:0002028 [regulation of sodium ion transport] evidence: ISS
GeneID:7533 -> Biological process: GO:0006713 [glucocorticoid catabolic process] evidence: IDA
GeneID:7533 -> Biological process: GO:0006886 [intracellular protein transport] evidence: ISS
GeneID:7533 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:7533 -> Biological process: GO:0016044 [cellular membrane organization] evidence: TAS
GeneID:7533 -> Biological process: GO:0042921 [glucocorticoid receptor signaling pathway] evidence: IDA
GeneID:7533 -> Biological process: GO:0045664 [regulation of neuron differentiation] evidence: ISS
GeneID:7533 -> Biological process: GO:0045893 [positive regulation of transcription, DNA-dependent] evidence: IDA
GeneID:7533 -> Biological process: GO:0048167 [regulation of synaptic plasticity] evidence: ISS
GeneID:7533 -> Biological process: GO:0050774 [negative regulation of dendrite morphogenesis] evidence: ISS
GeneID:7533 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS
GeneID:7533 -> Biological process: GO:1900740 [positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: TAS
GeneID:7533 -> Biological process: GO:2000649 [regulation of sodium ion transmembrane transporter activity] evidence: ISS
GeneID:7533 -> Cellular component: GO:0005737 [cytoplasm] evidence: ISS
GeneID:7533 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:7533 -> Cellular component: GO:0014704 [intercalated disc] evidence: IC
GeneID:7533 -> Cellular component: GO:0030659 [cytoplasmic vesicle membrane] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.