2024-04-24 13:52:18, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_003404 3231 bp mRNA linear PRI 04-JUL-2013 DEFINITION Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide (YWHAB), transcript variant 1, mRNA. ACCESSION NM_003404 NM_014052 VERSION NM_003404.4 GI:520975501 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 3231) AUTHORS Jeong BH, Jin HT, Choi EK, Carp RI and Kim YS. TITLE Lack of association between 14-3-3 beta gene (YWHAB) polymorphisms and sporadic Creutzfeldt-Jakob disease (CJD) JOURNAL Mol. Biol. Rep. 39 (12), 10647-10653 (2012) PUBMED 23053962 REMARK GeneRIF: These results indicate that the six YWHAB polymorphisms are not associated with the genetic susceptibility to sporadic Creutzfeldt-Jakob disease. REFERENCE 2 (bases 1 to 3231) AUTHORS Liang X, Da Paula AC, Bozoky Z, Zhang H, Bertrand CA, Peters KW, Forman-Kay JD and Frizzell RA. TITLE Phosphorylation-dependent 14-3-3 protein interactions regulate CFTR biogenesis JOURNAL Mol. Biol. Cell 23 (6), 996-1009 (2012) PUBMED 22278744 REMARK GeneRIF: 14-3-3beta binding to phosphorylated CFTR augments its biogenesis by reducing retrograde retrieval of CFTR to the endoplasmic reticulum. This mechanism permits cAMP/PKA stimulation to make more CFTR available for anion secretion. REFERENCE 3 (bases 1 to 3231) AUTHORS Asdaghi N, Kilani RT, Hosseini-Tabatabaei A, Odemuyiwa SO, Hackett TL, Knight DA, Ghahary A and Moqbel R. TITLE Extracellular 14-3-3 from human lung epithelial cells enhances MMP-1 expression JOURNAL Mol. Cell. Biochem. 360 (1-2), 261-270 (2012) PUBMED 21948273 REMARK GeneRIF: Modulation of matrix metalloproteinase 1 by 14-3beta/alpha, may be important in the alteration of collagenase production associated with airway remodelling in obstructive lung diseases REFERENCE 4 (bases 1 to 3231) AUTHORS Petri MK, Koch P, Stenzinger A, Kuchelmeister K, Nestler U, Paradowska A, Steger K, Brobeil A, Viard M and Wimmer M. TITLE PTPIP51, a positive modulator of the MAPK/Erk pathway, is upregulated in glioblastoma and interacts with 14-3-3beta and PTP1B in situ JOURNAL Histol. Histopathol. 26 (12), 1531-1543 (2011) PUBMED 21972092 REMARK GeneRIF: In glioblastoma PTPIP51 expression increases with the grade of malignancy and PTPIP51 interacts in situ with 14-3-3ss and PTP1B. REFERENCE 5 (bases 1 to 3231) AUTHORS O'Dwyer D, Ralton LD, O'Shea A and Murray GI. TITLE The proteomics of colorectal cancer: identification of a protein signature associated with prognosis JOURNAL PLoS ONE 6 (11), E27718 (2011) PUBMED 22125622 REMARK GeneRIF: Data identified 14-3-3beta as a prognostic biomarker. REFERENCE 6 (bases 1 to 3231) AUTHORS Tommerup N and Leffers H. TITLE Assignment of the human genes encoding 14,3-3 Eta (YWHAH) to 22q12, 14-3-3 zeta (YWHAZ) to 2p25.1-p25.2, and 14-3-3 beta (YWHAB) to 20q13.1 by in situ hybridization JOURNAL Genomics 33 (1), 149-150 (1996) PUBMED 8617504 REFERENCE 7 (bases 1 to 3231) AUTHORS Conklin DS, Galaktionov K and Beach D. TITLE 14-3-3 proteins associate with cdc25 phosphatases JOURNAL Proc. Natl. Acad. Sci. U.S.A. 92 (17), 7892-7896 (1995) PUBMED 7644510 REFERENCE 8 (bases 1 to 3231) AUTHORS Aitken A, Howell S, Jones D, Madrazo J and Patel Y. TITLE 14-3-3 alpha and delta are the phosphorylated forms of raf-activating 14-3-3 beta and zeta. In vivo stoichiometric phosphorylation in brain at a Ser-Pro-Glu-Lys MOTIF JOURNAL J. Biol. Chem. 270 (11), 5706-5709 (1995) PUBMED 7890696 REFERENCE 9 (bases 1 to 3231) AUTHORS Roth D, Morgan A, Martin H, Jones D, Martens GJ, Aitken A and Burgoyne RD. TITLE Characterization of 14-3-3 proteins in adrenal chromaffin cells and demonstration of isoform-specific phospholipid binding JOURNAL Biochem. J. 301 (PT 1), 305-310 (1994) PUBMED 8037685 REFERENCE 10 (bases 1 to 3231) AUTHORS Leffers H, Madsen P, Rasmussen HH, Honore B, Andersen AH, Walbum E, Vandekerckhove J and Celis JE. TITLE Molecular cloning and expression of the transformation sensitive epithelial marker stratifin. A member of a protein family that has been involved in the protein kinase C signalling pathway JOURNAL J. Mol. Biol. 231 (4), 982-998 (1993) PUBMED 8515476 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DB443535.1, AK292717.1, AL008725.1 and AA845374.1. On Jul 4, 2013 this sequence version replaced gi:31742479. Summary: This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (1) represents the longer transcript. Variants 1 and 2 both encode the same protein. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: X57346.1, AK292717.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-250 DB443535.1 55-304 251-1193 AK292717.1 144-1086 1194-2738 AL008725.1 61634-63178 2739-3231 AA845374.1 1-493 c FEATURES Location/Qualifiers source 1..3231 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="20" /map="20q13.1" gene 1..3231 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /note="tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide" /db_xref="GeneID:7529" /db_xref="HGNC:12849" /db_xref="HPRD:03184" /db_xref="MIM:601289" exon 1..288 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /inference="alignment:Splign:1.39.8" misc_feature 219..221 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /note="upstream in-frame stop codon" exon 289..383 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /inference="alignment:Splign:1.39.8" exon 384..686 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /inference="alignment:Splign:1.39.8" CDS 387..1127 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /note="tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, alpha polypeptide; 14-3-3 alpha; protein kinase C inhibitor protein-1; protein 1054; brain protein 14-3-3, beta isoform; protein kinase C inhibitor protein 1" /codon_start=1 /product="14-3-3 protein beta/alpha" /protein_id="NP_003395.1" /db_xref="GI:4507949" /db_xref="CCDS:CCDS13339.1" /db_xref="GeneID:7529" /db_xref="HGNC:12849" /db_xref="HPRD:03184" /db_xref="MIM:601289" /translation="
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
" misc_feature 387..389 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /experiment="experimental evidence, no additional details recorded" /note="N-acetylmethionine, in 14-3-3 protein beta/alpha, alternate; propagated from UniProtKB/Swiss-Prot (P31946.3); acetylation site" misc_feature 390..392 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /experiment="experimental evidence, no additional details recorded" /note="N-acetylthreonine, in 14-3-3 protein beta/alpha, N-terminally processed; propagated from UniProtKB/Swiss-Prot (P31946.3); acetylation site" misc_feature 396..1082 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /note="14-3-3 beta and zeta isoforms of 14-3-3 protein; Region: 14-3-3_beta_zeta; cd10022" /db_xref="CDD:206758" misc_feature order(405..407,414..419,426..431,435..440,444..446, 453..455,564..566,573..575,585..587,615..617,624..629, 636..638,645..650,657..659) /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:206758" misc_feature order(513..518,525..530,537..539,741..743,750..752, 771..776,885..887,897..899,906..911,918..920,1017..1031, 1038..1043,1050..1052,1062..1064) /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /note="peptide binding site [polypeptide binding]; other site" /db_xref="CDD:206758" misc_feature 558..560 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /inference="non-experimental evidence, no additional details recorded" /note="Interaction with phosphoserine on interacting protein (By similarity); propagated from UniProtKB/Swiss-Prot (P31946.3); other site" misc_feature 594..596 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /experiment="experimental evidence, no additional details recorded" /note="N6-acetyllysine; propagated from UniProtKB/Swiss-Prot (P31946.3); acetylation site" misc_feature 735..737 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /experiment="experimental evidence, no additional details recorded" /note="N6-acetyllysine; propagated from UniProtKB/Swiss-Prot (P31946.3); acetylation site" misc_feature 771..773 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /inference="non-experimental evidence, no additional details recorded" /note="Interaction with phosphoserine on interacting protein (By similarity); propagated from UniProtKB/Swiss-Prot (P31946.3); other site" misc_feature 780..782 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01504" misc_feature 813..815 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01504" misc_feature 942..944 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /citation=[8] exon 687..810 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /inference="alignment:Splign:1.39.8" exon 811..974 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /inference="alignment:Splign:1.39.8" STS 823..979 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /standard_name="STS-N23075" /db_xref="UniSTS:6129" STS 932..1068 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /standard_name="STS-X57346" /db_xref="UniSTS:46319" exon 975..1070 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /inference="alignment:Splign:1.39.8" STS 1062..1250 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /standard_name="RH66089" /db_xref="UniSTS:89219" exon 1071..3221 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /inference="alignment:Splign:1.39.8" STS 1305..1435 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /standard_name="SHGC-37252" /db_xref="UniSTS:16827" STS 1470..2187 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /standard_name="YWHAB__v346" /db_xref="UniSTS:277869" STS 1922..2025 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /standard_name="D20S586E" /db_xref="UniSTS:48879" STS 2006..2108 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /standard_name="D20S556E" /db_xref="UniSTS:88619" STS 2953..3057 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" /standard_name="D20S528E" /db_xref="UniSTS:150763" polyA_signal 3190..3195 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" polyA_site 3221 /gene="YWHAB" /gene_synonym="GW128; HS1; KCIP-1; YWHAA" ORIGIN
gcgcccctcccgtggggccgtggcaaccccgtgcctcgcttgcccaatgagaacacggtttggggcggggcgcggccaggaccggagcggaagtggcgatcggagcggaagtggagctaccgccaccgccgccgccgattccggagccggggtagtcgccgccgccgccgccgctgcagccactgcaggcaccgctgccgccgcctgagtagtgggcttaggaaggaagaggtcatctcgctcggagcttcgctcggaagggtctttgttccctgcagccctcccacggcagagtctccagagatttgggccgctacaaaaagtgcattttgcccattcggctgtggatagagaagcaggaagagcactggacttggagtcagggaatgacaatggataaaagtgagctggtacagaaagccaaactcgctgagcaggctgagcgatatgatgatatggctgcagccatgaaggcagtcacagaacaggggcatgaactctccaacgaagagagaaatctgctctctgttgcctacaagaatgtggtaggcgcccgccgctcttcctggcgtgtcatctccagcattgagcagaaaacagagaggaatgagaagaagcagcagatgggcaaagagtaccgtgagaagatagaggcagaactgcaggacatctgcaatgatgttctggagctgttggacaaatatcttattcccaatgctacacaaccagaaagtaaggtgttctacttgaaaatgaaaggagattattttaggtatctttctgaagtggcatctggagacaacaaacaaaccactgtgtcgaactcccagcaggcttaccaggaagcatttgaaattagtaagaaagaaatgcagcctacacacccaattcgtcttggtctggcactaaatttctcagtcttttactatgagattctaaactctcctgaaaaggcctgtagcctggcaaaaacggcatttgatgaagcaattgctgaattggatacgctgaatgaagagtcttataaagacagcactctgatcatgcagttacttagggacaatctcactctgtggacatcggaaaaccagggagacgaaggagacgctggggagggagagaactaatgtttctcgtgctttgtgatctgttcagtgtcactctgtaccctcaacatatatcccttgtgcgataaaaaaaaaaaaaaaaaaaaaaagagaatcgtacgtcgactttcgatttttcacagcctcagcctaggaaaaatggttcatgggataaacagctggtatttgtatctaaaactcagattggtcacataaatgccacggcattccgaagttttgattttgattaacattgacaggattactgtgtgtttaattttttaaaaactgaacactgtgattatggggttttgtaatttagcagaactcttactggtagaaaaaatagacctgaattatgtgtaactttttggaaggtttaatctgatatcaaaataatcattgaaatacaattccattgtaaagttgtacagaaagttatagagattatattgtgatgctggaacttggagtgagacacacatcatttggcatttgagttgaatggtaattcacagtaatgctgccgttgttcgggacttaaagacacttgacctgtttgggctgttgccacttaaaagttcatgaccacaaatgtccacagtgtcttcctctgaggaaactcgaatcctgaaatggaaattctttgtggcagataactggcttatgacaccttgaaaagttcaagtgctcatataacacaccacactgaaccccctttcctacagcaatatgttcactatgttaccaatttgcaacttgtgcttcaatagtggaatctactttcattgttaacactgagctaaagaaaaaaagccgtgtgttttatgaatgaccttatctgtttcctggataatacctttaagaataatgtcctgagtcaggcgtggtggtgcgtgcatctagtcccaactatttgggaggctgaggcaggaggatcgcttgagcccaggagtttaaagctgcagtgccctgtggttgcacctgtgaataactgcactccagcctgggcaacatagcgagacctcatctccaaaaaagaaaacaaaaaacaaaaaaaggaatgatgttctgtagagatggcctttcacttgaggagtactcagttttcaggttcttcctagctcggggcttttaaattttgaaatctaaacattctttcccaccatcctttttgactgttgaccttggttttctcttctaagtttctgtccctctgcttccttactttttttcctttttgaattctatctttatctgtcttttgttcactttttaatgctatatatgggcaggggtgagagacattactgagcaccttggtgagcaagcctggctttaaagattggagaagagcttctggcaccagaaccctgtcttcctccagttctcaacacggtgttgctcttcagtcataccggaatctgaatcaaaaaagtatttttaaatatccatgatttctccctgtattgaggctagccctgatcatgctttttgtgcctgtcaccaggtctcccaagtgcactcatccaggtcagtgctcagatgtgtttaaggagaccctatattcagggaagttgcgtgaacactgcagtggggagaattgagaatagtcaggcctatcagtctcacagaatcacccctctacctttgatattccacttagctgtagagtccatctgtttgtccatctgctgaaatgagaaaagaaaaatttatgcactgatttaaaacaaaccaaaaaaaaagaaaaaaacaaaaaaaaaaatccctcctttctagctgaacaaaaatgtgcagttaatacttggcgcttgaaaatgcagtagtgaatgtggaaccaagcctgtctgtatatctggtagctcttttcttgctttgttttttcttaccagtattctgcctaacgtttgcttctgtgatggttatattgcctagcaagcacacccgtggttgtgaaaatagtatagcaaaaaagaaaaatccccggttattgatgtactagatttgtgtatgtcttttaaacagttctagtttcaccttacacagaataatcaggaaaagtgtaaaaattcaaaagtgaaataaaaattttatcagttagttgcctgtgaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:7529 -> Molecular function: GO:0003714 [transcription corepressor activity] evidence: IEA GeneID:7529 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:7529 -> Molecular function: GO:0008022 [protein C-terminus binding] evidence: IEA GeneID:7529 -> Molecular function: GO:0019899 [enzyme binding] evidence: IPI GeneID:7529 -> Molecular function: GO:0019904 [protein domain specific binding] evidence: IPI GeneID:7529 -> Molecular function: GO:0032403 [protein complex binding] evidence: IEA GeneID:7529 -> Molecular function: GO:0042826 [histone deacetylase binding] evidence: IPI GeneID:7529 -> Molecular function: GO:0050815 [phosphoserine binding] evidence: IPI GeneID:7529 -> Molecular function: GO:0051219 [phosphoprotein binding] evidence: IPI GeneID:7529 -> Biological process: GO:0000165 [MAPK cascade] evidence: TAS GeneID:7529 -> Biological process: GO:0000186 [activation of MAPKK activity] evidence: TAS GeneID:7529 -> Biological process: GO:0006605 [protein targeting] evidence: IEA GeneID:7529 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:7529 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS GeneID:7529 -> Biological process: GO:0007264 [small GTPase mediated signal transduction] evidence: TAS GeneID:7529 -> Biological process: GO:0007265 [Ras protein signal transduction] evidence: TAS GeneID:7529 -> Biological process: GO:0007411 [axon guidance] evidence: TAS GeneID:7529 -> Biological process: GO:0008286 [insulin receptor signaling pathway] evidence: TAS GeneID:7529 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: TAS GeneID:7529 -> Biological process: GO:0010467 [gene expression] evidence: TAS GeneID:7529 -> Biological process: GO:0016044 [cellular membrane organization] evidence: TAS GeneID:7529 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS GeneID:7529 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS GeneID:7529 -> Biological process: GO:0035308 [negative regulation of protein dephosphorylation] evidence: IDA GeneID:7529 -> Biological process: GO:0035329 [hippo signaling cascade] evidence: TAS GeneID:7529 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS GeneID:7529 -> Biological process: GO:0043085 [positive regulation of catalytic activity] evidence: IDA GeneID:7529 -> Biological process: GO:0045087 [innate immune response] evidence: TAS GeneID:7529 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: IEA GeneID:7529 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS GeneID:7529 -> Biological process: GO:0051220 [cytoplasmic sequestering of protein] evidence: IDA GeneID:7529 -> Biological process: GO:0051291 [protein heterooligomerization] evidence: IEA GeneID:7529 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS GeneID:7529 -> Biological process: GO:1900740 [positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: TAS GeneID:7529 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA GeneID:7529 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:7529 -> Cellular component: GO:0017053 [transcriptional repressor complex] evidence: IEA GeneID:7529 -> Cellular component: GO:0030659 [cytoplasmic vesicle membrane] evidence: TAS GeneID:7529 -> Cellular component: GO:0042470 [melanosome] evidence: IEA GeneID:7529 -> Cellular component: GO:0048471 [perinuclear region of cytoplasm] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.