2024-04-18 11:24:35, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002954 1068 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens ribosomal protein S27a (RPS27A), transcript variant 1, mRNA. ACCESSION NM_002954 VERSION NM_002954.5 GI:294459919 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1068) AUTHORS Knaup,J., Verwanger,T., Gruber,C., Ziegler,V., Bauer,J.W. and Krammer,B. TITLE Epidermolysis bullosa - a group of skin diseases with different causes but commonalities in gene expression JOURNAL Exp. Dermatol. 21 (7), 526-530 (2012) PUBMED 22716248 REMARK GeneRIF: Gene expression profiles showed that RPS27A was down-regulated in epidermolysis bullosa subtypes. REFERENCE 2 (bases 1 to 1068) AUTHORS Sun,X.X., DeVine,T., Challagundla,K.B. and Dai,M.S. TITLE Interplay between ribosomal protein S27a and MDM2 protein in p53 activation in response to ribosomal stress JOURNAL J. Biol. Chem. 286 (26), 22730-22741 (2011) PUBMED 21561866 REMARK GeneRIF: S27a plays a non-redundant role in mediating p53 activation in response to ribosomal stress via interplaying with MDM2. REFERENCE 3 (bases 1 to 1068) AUTHORS Gazda,H.T., Sheen,M.R., Vlachos,A., Choesmel,V., O'Donohue,M.F., Schneider,H., Darras,N., Hasman,C., Sieff,C.A., Newburger,P.E., Ball,S.E., Niewiadomska,E., Matysiak,M., Zaucha,J.M., Glader,B., Niemeyer,C., Meerpohl,J.J., Atsidaftos,E., Lipton,J.M., Gleizes,P.E. and Beggs,A.H. TITLE Ribosomal protein L5 and L11 mutations are associated with cleft palate and abnormal thumbs in Diamond-Blackfan anemia patients JOURNAL Am. J. Hum. Genet. 83 (6), 769-780 (2008) PUBMED 19061985 REFERENCE 4 (bases 1 to 1068) AUTHORS Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z., Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S., McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J., Dunham,I., Hill,D.E. and Vidal,M. TITLE hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes JOURNAL Genomics 89 (3), 307-315 (2007) PUBMED 17207965 REFERENCE 5 (bases 1 to 1068) AUTHORS Memet,S. TITLE NF-kappaB functions in the nervous system: from development to disease JOURNAL Biochem. Pharmacol. 72 (9), 1180-1195 (2006) PUBMED 16997282 REMARK Review article REFERENCE 6 (bases 1 to 1068) AUTHORS Adams,S.M., Sharp,M.G., Walker,R.A., Brammar,W.J. and Varley,J.M. TITLE Differential expression of translation-associated genes in benign and malignant human breast tumours JOURNAL Br. J. Cancer 65 (1), 65-71 (1992) PUBMED 1370760 REFERENCE 7 (bases 1 to 1068) AUTHORS Kanayama,H., Tanaka,K., Aki,M., Kagawa,S., Miyaji,H., Satoh,M., Okada,F., Sato,S., Shimbara,N. and Ichihara,A. TITLE Changes in expressions of proteasome and ubiquitin genes in human renal cancer cells JOURNAL Cancer Res. 51 (24), 6677-6685 (1991) PUBMED 1660345 REFERENCE 8 (bases 1 to 1068) AUTHORS Pancre,V., Pierce,R.J., Fournier,F., Mehtali,M., Delanoye,A., Capron,A. and Auriault,C. TITLE Effect of ubiquitin on platelet functions: possible identity with platelet activity suppressive lymphokine (PASL) JOURNAL Eur. J. Immunol. 21 (11), 2735-2741 (1991) PUBMED 1657614 REFERENCE 9 (bases 1 to 1068) AUTHORS Redman,K.L. and Rechsteiner,M. TITLE Identification of the long ubiquitin extension as ribosomal protein S27a JOURNAL Nature 338 (6214), 438-440 (1989) PUBMED 2538756 REFERENCE 10 (bases 1 to 1068) AUTHORS Monia,B.P., Ecker,D.J., Jonnalagadda,S., Marsh,J., Gotlib,L., Butt,T.R. and Crooke,S.T. TITLE Gene synthesis, expression, and processing of human ubiquitin carboxyl extension proteins JOURNAL J. Biol. Chem. 264 (7), 4093-4103 (1989) PUBMED 2537304 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff in collaboration with Francesco Amaldi. The reference sequence was derived from CR746519.1, BC066293.1 and AC012358.9. On Apr 9, 2010 this sequence version replaced gi:208022620. Summary: Ubiquitin, a highly conserved protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome, is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein S27a at the C terminus. When expressed in yeast, the protein is post-translationally processed, generating free ubiquitin monomer and ribosomal protein S27a. Ribosomal protein S27a is a component of the 40S subunit of the ribosome and belongs to the S27AE family of ribosomal proteins. It contains C4-type zinc finger domains and is located in the cytoplasm. Pseudogenes derived from this gene are present in the genome. As with ribosomal protein S27a, ribosomal protein L40 is also synthesized as a fusion protein with ubiquitin; similarly, ribosomal protein S30 is synthesized as a fusion protein with the ubiquitin-like protein fubi. Multiple alternatively spliced transcript variants that encode the same proteins have been identified.[provided by RefSeq, Sep 2008]. Transcript Variant: This variant (1) represents the longest transcript. Variants 1, 2 and 3 encode the same protein. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BG576569.1, CD172931.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-283 CR746519.1 12-294 284-822 BC066293.1 1-539 823-1068 AC012358.9 40015-40260 FEATURES Location/Qualifiers source 1..1068 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="2" /map="2p16" gene 1..1068 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /note="ribosomal protein S27a" /db_xref="GeneID:6233" /db_xref="HGNC:10417" /db_xref="HPRD:01878" /db_xref="MIM:191343" exon 1..304 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /inference="alignment:Splign:1.39.8" variation 4 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:147873889" variation 6 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="c" /replace="t" /db_xref="dbSNP:182340529" variation 130 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:115477709" variation 132 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:111458298" variation 192 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="c" /replace="g" /db_xref="dbSNP:139327606" misc_feature 223..225 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /note="upstream in-frame stop codon" variation 253 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:187450927" exon 305..369 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /inference="alignment:Splign:1.39.8" variation 305 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="g" /replace="t" /db_xref="dbSNP:3211295" CDS 322..792 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /note="ubiquitin and ribosomal protein S27a; ubiquitin-CEP80; ubiquitin-40S ribosomal protein S27a; ubiquitin carboxyl extension protein 80; ubiquitin C" /codon_start=1 /product="ubiquitin-40S ribosomal protein S27a precursor" /protein_id="NP_002945.1" /db_xref="GI:4506713" /db_xref="CCDS:CCDS33202.1" /db_xref="GeneID:6233" /db_xref="HGNC:10417" /db_xref="HPRD:01878" /db_xref="MIM:191343" /translation="
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
" misc_feature 322..549 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /note="Ubiquitin; Region: Ubiquitin; cd01803" /db_xref="CDD:176398" mat_peptide 322..549 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /product="ubiquitin" misc_feature 322..537 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /note="Ubiquitin homologues; Region: UBQ; smart00213" /db_xref="CDD:214563" misc_feature order(337..351,439..441,445..447,451..453,460..468, 523..525,529..549) /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /note="Ubq - E2 interaction site; other site" /db_xref="CDD:176398" misc_feature order(337..339,343..351,436..438,442..447,517..519, 523..525,529..549) /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /note="Ubq - UCH interaction site; other site" /db_xref="CDD:176398" misc_feature order(337..339,343..345,451..453,457..468,523..525, 529..531,535..537,547..549) /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /note="Ubq - CUE interaction site; other site" /db_xref="CDD:176398" misc_feature 514..516 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" misc_feature 523..525 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /experiment="experimental evidence, no additional details recorded" /note="Essential for function; propagated from UniProtKB/Swiss-Prot (P62979.2); other site" mat_peptide 550..789 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /product="ribosomal protein S27a" misc_feature 631..633 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /experiment="experimental evidence, no additional details recorded" /note="N6-acetyllysine; propagated from UniProtKB/Swiss-Prot (P62979.2); acetylation site" misc_feature 646..762 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /note="Ribosomal protein S27a; Region: Ribosomal_S27; pfam01599" /db_xref="CDD:110592" misc_feature 658..660 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /experiment="experimental evidence, no additional details recorded" /note="N6-acetyllysine; propagated from UniProtKB/Swiss-Prot (P62979.2); acetylation site" variation 327 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:370364740" variation 339 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:150257026" exon 370..424 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /inference="alignment:Splign:1.39.8" variation 380 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="c" /replace="t" /db_xref="dbSNP:368266147" variation 396 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="c" /replace="t" /db_xref="dbSNP:376004033" variation 398 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:11557870" variation 404 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="c" /replace="t" /db_xref="dbSNP:369415573" STS 411..707 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /standard_name="PMC280674P2" /db_xref="UniSTS:272400" exon 425..510 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /inference="alignment:Splign:1.39.8" variation 436 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="c" /replace="g" /db_xref="dbSNP:11557879" variation 465 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:199783736" variation 471 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:140629236" variation 490 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="c" /replace="t" /db_xref="dbSNP:11557872" variation 500 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:200025668" exon 511..642 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /inference="alignment:Splign:1.39.8" variation 535 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="c" /db_xref="dbSNP:2230613" variation 591 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:141734431" variation 596 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="c" /db_xref="dbSNP:367545449" STS 613..765 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /standard_name="D2S2663" /db_xref="UniSTS:58896" variation 618 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:371677578" exon 643..1068 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /inference="alignment:Splign:1.39.8" variation 646 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:13028202" variation 649 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:13028392" variation 663 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="t" /db_xref="dbSNP:140387708" variation 714 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="c" /replace="t" /db_xref="dbSNP:137921682" variation 741 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="c" /replace="t" /db_xref="dbSNP:147381871" variation 748 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="t" /db_xref="dbSNP:11557873" variation 773 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:149878551" variation 780 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:201026490" variation 788 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:369519274" variation 793 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="c" /db_xref="dbSNP:148807785" polyA_signal 804..809 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" variation 824 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="g" /db_xref="dbSNP:375702426" variation 826 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="c" /replace="t" /db_xref="dbSNP:74733706" polyA_site 828 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" variation 832 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="c" /replace="t" /db_xref="dbSNP:200893583" variation 847 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="c" /replace="g" /db_xref="dbSNP:143376339" variation 860 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="" /replace="t" /db_xref="dbSNP:375779217" variation 911 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="g" /replace="t" /db_xref="dbSNP:146159099" variation 1042 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="c" /replace="t" /db_xref="dbSNP:187238769" variation 1058 /gene="RPS27A" /gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80" /replace="a" /replace="t" /db_xref="dbSNP:138978188" ORIGIN
ctcgacctccttttaaaaattctcttagccacgttgattgtacgggaaaagcctttttaaaacatcttttacgttgcttaaacctacagtttcgaaagcattccgaaggctaaagtgagaaataagcccaggctagggagaggagaaacgaagttcacgtcctagtctggcaccgggttggattgtcgctgggacggcagtcaggcatttggtgtggtcgcctaaggggtgggtccttcggcgggagctccgggaaaccccgtgggcctgcgcggcgttcttccttttcgatccgccatctgcggtggagccgccaccaaaatgcagattttcgtgaaaacccttacggggaagaccatcaccctcgaggttgaaccctcggatacgatagaaaatgtaaaggccaagatccaggataaggaaggaattcctcctgatcagcagagactgatctttgctggcaagcagctggaagatggacgtactttgtctgactacaatattcaaaaggagtctactcttcatcttgtgttgagacttcgtggtggtgctaagaaaaggaagaagaagtcttacaccactcccaagaagaataagcacaagagaaagaaggttaagctggctgtcctgaaatattataaggtggatgagaatggcaaaattagtcgccttcgtcgagagtgcccttctgatgaatgtggtgctggggtgtttatggcaagtcactttgacagacattattgtggcaaatgttgtctgacttactgtttcaacaaaccagaagacaagtaactgtatgagttaataaaagacatgaactaacatttattgttgggttttattgcagtaaaaagaatggtttttaagcaccaaattgatggtcacaccatttccttttagtagtgctactgctatcgctgtgtgaatgttgcctctggggattatgtgacccagtggttctgtatacctgccaggtgccaaccacttgtaaaggtcttgatattttcaattcttagactacctatactttggcagaagttatatttaatgtaagttgtctaaatataa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:6233 -> Molecular function: GO:0003735 [structural constituent of ribosome] evidence: IDA GeneID:6233 -> Molecular function: GO:0046872 [metal ion binding] evidence: IEA GeneID:6233 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS GeneID:6233 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: TAS GeneID:6233 -> Biological process: GO:0000184 [nuclear-transcribed mRNA catabolic process, nonsense-mediated decay] evidence: TAS GeneID:6233 -> Biological process: GO:0000187 [activation of MAPK activity] evidence: TAS GeneID:6233 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: TAS GeneID:6233 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS GeneID:6233 -> Biological process: GO:0002224 [toll-like receptor signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS GeneID:6233 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS GeneID:6233 -> Biological process: GO:0002755 [MyD88-dependent toll-like receptor signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0002756 [MyD88-independent toll-like receptor signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0006281 [DNA repair] evidence: TAS GeneID:6233 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: TAS GeneID:6233 -> Biological process: GO:0006367 [transcription initiation from RNA polymerase II promoter] evidence: TAS GeneID:6233 -> Biological process: GO:0006412 [translation] evidence: IC GeneID:6233 -> Biological process: GO:0006412 [translation] evidence: TAS GeneID:6233 -> Biological process: GO:0006413 [translational initiation] evidence: TAS GeneID:6233 -> Biological process: GO:0006414 [translational elongation] evidence: TAS GeneID:6233 -> Biological process: GO:0006415 [translational termination] evidence: TAS GeneID:6233 -> Biological process: GO:0006614 [SRP-dependent cotranslational protein targeting to membrane] evidence: TAS GeneID:6233 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:6233 -> Biological process: GO:0006977 [DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest] evidence: TAS GeneID:6233 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0007179 [transforming growth factor beta receptor signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0007219 [Notch signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0007220 [Notch receptor processing] evidence: TAS GeneID:6233 -> Biological process: GO:0007249 [I-kappaB kinase/NF-kappaB cascade] evidence: TAS GeneID:6233 -> Biological process: GO:0007254 [JNK cascade] evidence: TAS GeneID:6233 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0010467 [gene expression] evidence: TAS GeneID:6233 -> Biological process: GO:0016032 [viral process] evidence: TAS GeneID:6233 -> Biological process: GO:0016044 [cellular membrane organization] evidence: TAS GeneID:6233 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS GeneID:6233 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS GeneID:6233 -> Biological process: GO:0016197 [endosomal transport] evidence: TAS GeneID:6233 -> Biological process: GO:0019058 [viral infectious cycle] evidence: TAS GeneID:6233 -> Biological process: GO:0019067 [viral assembly, maturation, egress, and release] evidence: TAS GeneID:6233 -> Biological process: GO:0019068 [virion assembly] evidence: TAS GeneID:6233 -> Biological process: GO:0019082 [viral protein processing] evidence: TAS GeneID:6233 -> Biological process: GO:0019083 [viral transcription] evidence: TAS GeneID:6233 -> Biological process: GO:0019221 [cytokine-mediated signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0030512 [negative regulation of transforming growth factor beta receptor signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS GeneID:6233 -> Biological process: GO:0032479 [regulation of type I interferon production] evidence: TAS GeneID:6233 -> Biological process: GO:0032480 [negative regulation of type I interferon production] evidence: TAS GeneID:6233 -> Biological process: GO:0032481 [positive regulation of type I interferon production] evidence: TAS GeneID:6233 -> Biological process: GO:0034134 [toll-like receptor 2 signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0034138 [toll-like receptor 3 signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0034142 [toll-like receptor 4 signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0034146 [toll-like receptor 5 signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0034162 [toll-like receptor 9 signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0034166 [toll-like receptor 10 signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0034220 [ion transmembrane transport] evidence: TAS GeneID:6233 -> Biological process: GO:0035666 [TRIF-dependent toll-like receptor signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0035872 [nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0038123 [toll-like receptor TLR1:TLR2 signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0038124 [toll-like receptor TLR6:TLR2 signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0042059 [negative regulation of epidermal growth factor receptor signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS GeneID:6233 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS GeneID:6233 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: TAS GeneID:6233 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS GeneID:6233 -> Biological process: GO:0043123 [positive regulation of I-kappaB kinase/NF-kappaB cascade] evidence: TAS GeneID:6233 -> Biological process: GO:0044267 [cellular protein metabolic process] evidence: TAS GeneID:6233 -> Biological process: GO:0045087 [innate immune response] evidence: TAS GeneID:6233 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: TAS GeneID:6233 -> Biological process: GO:0046788 [egress of virus within host cell] evidence: TAS GeneID:6233 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0050852 [T cell receptor signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0051092 [positive regulation of NF-kappaB transcription factor activity] evidence: TAS GeneID:6233 -> Biological process: GO:0051403 [stress-activated MAPK cascade] evidence: TAS GeneID:6233 -> Biological process: GO:0051436 [negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS GeneID:6233 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS GeneID:6233 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS GeneID:6233 -> Biological process: GO:0055085 [transmembrane transport] evidence: TAS GeneID:6233 -> Biological process: GO:0061418 [regulation of transcription from RNA polymerase II promoter in response to hypoxia] evidence: TAS GeneID:6233 -> Biological process: GO:0070423 [nucleotide-binding oligomerization domain containing signaling pathway] evidence: TAS GeneID:6233 -> Biological process: GO:0071456 [cellular response to hypoxia] evidence: TAS GeneID:6233 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: TAS GeneID:6233 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS GeneID:6233 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:6233 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS GeneID:6233 -> Cellular component: GO:0010008 [endosome membrane] evidence: TAS GeneID:6233 -> Cellular component: GO:0015935 [small ribosomal subunit] evidence: IDA GeneID:6233 -> Cellular component: GO:0022627 [cytosolic small ribosomal subunit] evidence: IDA GeneID:6233 -> Cellular component: GO:0030666 [endocytic vesicle membrane] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.