Home |
Help |
Advanced search
2024-04-18 11:24:35, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002954 1068 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens ribosomal protein S27a (RPS27A), transcript variant 1,
mRNA.
ACCESSION NM_002954
VERSION NM_002954.5 GI:294459919
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1068)
AUTHORS Knaup,J., Verwanger,T., Gruber,C., Ziegler,V., Bauer,J.W. and
Krammer,B.
TITLE Epidermolysis bullosa - a group of skin diseases with different
causes but commonalities in gene expression
JOURNAL Exp. Dermatol. 21 (7), 526-530 (2012)
PUBMED 22716248
REMARK GeneRIF: Gene expression profiles showed that RPS27A was
down-regulated in epidermolysis bullosa subtypes.
REFERENCE 2 (bases 1 to 1068)
AUTHORS Sun,X.X., DeVine,T., Challagundla,K.B. and Dai,M.S.
TITLE Interplay between ribosomal protein S27a and MDM2 protein in p53
activation in response to ribosomal stress
JOURNAL J. Biol. Chem. 286 (26), 22730-22741 (2011)
PUBMED 21561866
REMARK GeneRIF: S27a plays a non-redundant role in mediating p53
activation in response to ribosomal stress via interplaying with
MDM2.
REFERENCE 3 (bases 1 to 1068)
AUTHORS Gazda,H.T., Sheen,M.R., Vlachos,A., Choesmel,V., O'Donohue,M.F.,
Schneider,H., Darras,N., Hasman,C., Sieff,C.A., Newburger,P.E.,
Ball,S.E., Niewiadomska,E., Matysiak,M., Zaucha,J.M., Glader,B.,
Niemeyer,C., Meerpohl,J.J., Atsidaftos,E., Lipton,J.M.,
Gleizes,P.E. and Beggs,A.H.
TITLE Ribosomal protein L5 and L11 mutations are associated with cleft
palate and abnormal thumbs in Diamond-Blackfan anemia patients
JOURNAL Am. J. Hum. Genet. 83 (6), 769-780 (2008)
PUBMED 19061985
REFERENCE 4 (bases 1 to 1068)
AUTHORS Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z.,
Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S.,
McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J.,
Dunham,I., Hill,D.E. and Vidal,M.
TITLE hORFeome v3.1: a resource of human open reading frames representing
over 10,000 human genes
JOURNAL Genomics 89 (3), 307-315 (2007)
PUBMED 17207965
REFERENCE 5 (bases 1 to 1068)
AUTHORS Memet,S.
TITLE NF-kappaB functions in the nervous system: from development to
disease
JOURNAL Biochem. Pharmacol. 72 (9), 1180-1195 (2006)
PUBMED 16997282
REMARK Review article
REFERENCE 6 (bases 1 to 1068)
AUTHORS Adams,S.M., Sharp,M.G., Walker,R.A., Brammar,W.J. and Varley,J.M.
TITLE Differential expression of translation-associated genes in benign
and malignant human breast tumours
JOURNAL Br. J. Cancer 65 (1), 65-71 (1992)
PUBMED 1370760
REFERENCE 7 (bases 1 to 1068)
AUTHORS Kanayama,H., Tanaka,K., Aki,M., Kagawa,S., Miyaji,H., Satoh,M.,
Okada,F., Sato,S., Shimbara,N. and Ichihara,A.
TITLE Changes in expressions of proteasome and ubiquitin genes in human
renal cancer cells
JOURNAL Cancer Res. 51 (24), 6677-6685 (1991)
PUBMED 1660345
REFERENCE 8 (bases 1 to 1068)
AUTHORS Pancre,V., Pierce,R.J., Fournier,F., Mehtali,M., Delanoye,A.,
Capron,A. and Auriault,C.
TITLE Effect of ubiquitin on platelet functions: possible identity with
platelet activity suppressive lymphokine (PASL)
JOURNAL Eur. J. Immunol. 21 (11), 2735-2741 (1991)
PUBMED 1657614
REFERENCE 9 (bases 1 to 1068)
AUTHORS Redman,K.L. and Rechsteiner,M.
TITLE Identification of the long ubiquitin extension as ribosomal protein
S27a
JOURNAL Nature 338 (6214), 438-440 (1989)
PUBMED 2538756
REFERENCE 10 (bases 1 to 1068)
AUTHORS Monia,B.P., Ecker,D.J., Jonnalagadda,S., Marsh,J., Gotlib,L.,
Butt,T.R. and Crooke,S.T.
TITLE Gene synthesis, expression, and processing of human ubiquitin
carboxyl extension proteins
JOURNAL J. Biol. Chem. 264 (7), 4093-4103 (1989)
PUBMED 2537304
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff in
collaboration with Francesco Amaldi. The reference sequence was
derived from CR746519.1, BC066293.1 and AC012358.9.
On Apr 9, 2010 this sequence version replaced gi:208022620.
Summary: Ubiquitin, a highly conserved protein that has a major
role in targeting cellular proteins for degradation by the 26S
proteosome, is synthesized as a precursor protein consisting of
either polyubiquitin chains or a single ubiquitin fused to an
unrelated protein. This gene encodes a fusion protein consisting of
ubiquitin at the N terminus and ribosomal protein S27a at the C
terminus. When expressed in yeast, the protein is
post-translationally processed, generating free ubiquitin monomer
and ribosomal protein S27a. Ribosomal protein S27a is a component
of the 40S subunit of the ribosome and belongs to the S27AE family
of ribosomal proteins. It contains C4-type zinc finger domains and
is located in the cytoplasm. Pseudogenes derived from this gene are
present in the genome. As with ribosomal protein S27a, ribosomal
protein L40 is also synthesized as a fusion protein with ubiquitin;
similarly, ribosomal protein S30 is synthesized as a fusion protein
with the ubiquitin-like protein fubi. Multiple alternatively
spliced transcript variants that encode the same proteins have been
identified.[provided by RefSeq, Sep 2008].
Transcript Variant: This variant (1) represents the longest
transcript. Variants 1, 2 and 3 encode the same protein.
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BG576569.1, CD172931.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-283 CR746519.1 12-294
284-822 BC066293.1 1-539
823-1068 AC012358.9 40015-40260
FEATURES Location/Qualifiers
source 1..1068
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="2"
/map="2p16"
gene 1..1068
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/note="ribosomal protein S27a"
/db_xref="GeneID:6233"
/db_xref="HGNC:10417"
/db_xref="HPRD:01878"
/db_xref="MIM:191343"
exon 1..304
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/inference="alignment:Splign:1.39.8"
variation 4
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:147873889"
variation 6
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="c"
/replace="t"
/db_xref="dbSNP:182340529"
variation 130
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:115477709"
variation 132
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:111458298"
variation 192
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="c"
/replace="g"
/db_xref="dbSNP:139327606"
misc_feature 223..225
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/note="upstream in-frame stop codon"
variation 253
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:187450927"
exon 305..369
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/inference="alignment:Splign:1.39.8"
variation 305
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="g"
/replace="t"
/db_xref="dbSNP:3211295"
CDS 322..792
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/note="ubiquitin and ribosomal protein S27a;
ubiquitin-CEP80; ubiquitin-40S ribosomal protein S27a;
ubiquitin carboxyl extension protein 80; ubiquitin C"
/codon_start=1
/product="ubiquitin-40S ribosomal protein S27a precursor"
/protein_id="NP_002945.1"
/db_xref="GI:4506713"
/db_xref="CCDS:CCDS33202.1"
/db_xref="GeneID:6233"
/db_xref="HGNC:10417"
/db_xref="HPRD:01878"
/db_xref="MIM:191343"
/translation="
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
"
misc_feature 322..549
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/note="Ubiquitin; Region: Ubiquitin; cd01803"
/db_xref="CDD:176398"
mat_peptide 322..549
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/product="ubiquitin"
misc_feature 322..537
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/note="Ubiquitin homologues; Region: UBQ; smart00213"
/db_xref="CDD:214563"
misc_feature order(337..351,439..441,445..447,451..453,460..468,
523..525,529..549)
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/note="Ubq - E2 interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(337..339,343..351,436..438,442..447,517..519,
523..525,529..549)
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/note="Ubq - UCH interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(337..339,343..345,451..453,457..468,523..525,
529..531,535..537,547..549)
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/note="Ubq - CUE interaction site; other site"
/db_xref="CDD:176398"
misc_feature 514..516
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 523..525
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/experiment="experimental evidence, no additional details
recorded"
/note="Essential for function; propagated from
UniProtKB/Swiss-Prot (P62979.2); other site"
mat_peptide 550..789
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/product="ribosomal protein S27a"
misc_feature 631..633
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P62979.2); acetylation site"
misc_feature 646..762
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/note="Ribosomal protein S27a; Region: Ribosomal_S27;
pfam01599"
/db_xref="CDD:110592"
misc_feature 658..660
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P62979.2); acetylation site"
variation 327
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:370364740"
variation 339
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:150257026"
exon 370..424
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/inference="alignment:Splign:1.39.8"
variation 380
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="c"
/replace="t"
/db_xref="dbSNP:368266147"
variation 396
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="c"
/replace="t"
/db_xref="dbSNP:376004033"
variation 398
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:11557870"
variation 404
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="c"
/replace="t"
/db_xref="dbSNP:369415573"
STS 411..707
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/standard_name="PMC280674P2"
/db_xref="UniSTS:272400"
exon 425..510
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/inference="alignment:Splign:1.39.8"
variation 436
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="c"
/replace="g"
/db_xref="dbSNP:11557879"
variation 465
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:199783736"
variation 471
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:140629236"
variation 490
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="c"
/replace="t"
/db_xref="dbSNP:11557872"
variation 500
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:200025668"
exon 511..642
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/inference="alignment:Splign:1.39.8"
variation 535
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="c"
/db_xref="dbSNP:2230613"
variation 591
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:141734431"
variation 596
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="c"
/db_xref="dbSNP:367545449"
STS 613..765
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/standard_name="D2S2663"
/db_xref="UniSTS:58896"
variation 618
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:371677578"
exon 643..1068
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/inference="alignment:Splign:1.39.8"
variation 646
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:13028202"
variation 649
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:13028392"
variation 663
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="t"
/db_xref="dbSNP:140387708"
variation 714
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="c"
/replace="t"
/db_xref="dbSNP:137921682"
variation 741
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="c"
/replace="t"
/db_xref="dbSNP:147381871"
variation 748
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="t"
/db_xref="dbSNP:11557873"
variation 773
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:149878551"
variation 780
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:201026490"
variation 788
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:369519274"
variation 793
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="c"
/db_xref="dbSNP:148807785"
polyA_signal 804..809
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
variation 824
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="g"
/db_xref="dbSNP:375702426"
variation 826
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="c"
/replace="t"
/db_xref="dbSNP:74733706"
polyA_site 828
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
variation 832
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="c"
/replace="t"
/db_xref="dbSNP:200893583"
variation 847
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="c"
/replace="g"
/db_xref="dbSNP:143376339"
variation 860
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace=""
/replace="t"
/db_xref="dbSNP:375779217"
variation 911
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="g"
/replace="t"
/db_xref="dbSNP:146159099"
variation 1042
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="c"
/replace="t"
/db_xref="dbSNP:187238769"
variation 1058
/gene="RPS27A"
/gene_synonym="CEP80; S27A; UBA80; UBC; UBCEP1; UBCEP80"
/replace="a"
/replace="t"
/db_xref="dbSNP:138978188"
ORIGIN
ctcgacctccttttaaaaattctcttagccacgttgattgtacgggaaaagcctttttaaaacatcttttacgttgcttaaacctacagtttcgaaagcattccgaaggctaaagtgagaaataagcccaggctagggagaggagaaacgaagttcacgtcctagtctggcaccgggttggattgtcgctgggacggcagtcaggcatttggtgtggtcgcctaaggggtgggtccttcggcgggagctccgggaaaccccgtgggcctgcgcggcgttcttccttttcgatccgccatctgcggtggagccgccaccaaaatgcagattttcgtgaaaacccttacggggaagaccatcaccctcgaggttgaaccctcggatacgatagaaaatgtaaaggccaagatccaggataaggaaggaattcctcctgatcagcagagactgatctttgctggcaagcagctggaagatggacgtactttgtctgactacaatattcaaaaggagtctactcttcatcttgtgttgagacttcgtggtggtgctaagaaaaggaagaagaagtcttacaccactcccaagaagaataagcacaagagaaagaaggttaagctggctgtcctgaaatattataaggtggatgagaatggcaaaattagtcgccttcgtcgagagtgcccttctgatgaatgtggtgctggggtgtttatggcaagtcactttgacagacattattgtggcaaatgttgtctgacttactgtttcaacaaaccagaagacaagtaactgtatgagttaataaaagacatgaactaacatttattgttgggttttattgcagtaaaaagaatggtttttaagcaccaaattgatggtcacaccatttccttttagtagtgctactgctatcgctgtgtgaatgttgcctctggggattatgtgacccagtggttctgtatacctgccaggtgccaaccacttgtaaaggtcttgatattttcaattcttagactacctatactttggcagaagttatatttaatgtaagttgtctaaatataa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:6233 -> Molecular function: GO:0003735 [structural constituent of ribosome] evidence: IDA
GeneID:6233 -> Molecular function: GO:0046872 [metal ion binding] evidence: IEA
GeneID:6233 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS
GeneID:6233 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: TAS
GeneID:6233 -> Biological process: GO:0000184 [nuclear-transcribed mRNA catabolic process, nonsense-mediated decay] evidence: TAS
GeneID:6233 -> Biological process: GO:0000187 [activation of MAPK activity] evidence: TAS
GeneID:6233 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: TAS
GeneID:6233 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:6233 -> Biological process: GO:0002224 [toll-like receptor signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS
GeneID:6233 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS
GeneID:6233 -> Biological process: GO:0002755 [MyD88-dependent toll-like receptor signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0002756 [MyD88-independent toll-like receptor signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0006281 [DNA repair] evidence: TAS
GeneID:6233 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: TAS
GeneID:6233 -> Biological process: GO:0006367 [transcription initiation from RNA polymerase II promoter] evidence: TAS
GeneID:6233 -> Biological process: GO:0006412 [translation] evidence: IC
GeneID:6233 -> Biological process: GO:0006412 [translation] evidence: TAS
GeneID:6233 -> Biological process: GO:0006413 [translational initiation] evidence: TAS
GeneID:6233 -> Biological process: GO:0006414 [translational elongation] evidence: TAS
GeneID:6233 -> Biological process: GO:0006415 [translational termination] evidence: TAS
GeneID:6233 -> Biological process: GO:0006614 [SRP-dependent cotranslational protein targeting to membrane] evidence: TAS
GeneID:6233 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:6233 -> Biological process: GO:0006977 [DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest] evidence: TAS
GeneID:6233 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0007179 [transforming growth factor beta receptor signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0007219 [Notch signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0007220 [Notch receptor processing] evidence: TAS
GeneID:6233 -> Biological process: GO:0007249 [I-kappaB kinase/NF-kappaB cascade] evidence: TAS
GeneID:6233 -> Biological process: GO:0007254 [JNK cascade] evidence: TAS
GeneID:6233 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:6233 -> Biological process: GO:0016032 [viral process] evidence: TAS
GeneID:6233 -> Biological process: GO:0016044 [cellular membrane organization] evidence: TAS
GeneID:6233 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS
GeneID:6233 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS
GeneID:6233 -> Biological process: GO:0016197 [endosomal transport] evidence: TAS
GeneID:6233 -> Biological process: GO:0019058 [viral infectious cycle] evidence: TAS
GeneID:6233 -> Biological process: GO:0019067 [viral assembly, maturation, egress, and release] evidence: TAS
GeneID:6233 -> Biological process: GO:0019068 [virion assembly] evidence: TAS
GeneID:6233 -> Biological process: GO:0019082 [viral protein processing] evidence: TAS
GeneID:6233 -> Biological process: GO:0019083 [viral transcription] evidence: TAS
GeneID:6233 -> Biological process: GO:0019221 [cytokine-mediated signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0030512 [negative regulation of transforming growth factor beta receptor signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS
GeneID:6233 -> Biological process: GO:0032479 [regulation of type I interferon production] evidence: TAS
GeneID:6233 -> Biological process: GO:0032480 [negative regulation of type I interferon production] evidence: TAS
GeneID:6233 -> Biological process: GO:0032481 [positive regulation of type I interferon production] evidence: TAS
GeneID:6233 -> Biological process: GO:0034134 [toll-like receptor 2 signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0034138 [toll-like receptor 3 signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0034142 [toll-like receptor 4 signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0034146 [toll-like receptor 5 signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0034162 [toll-like receptor 9 signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0034166 [toll-like receptor 10 signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0034220 [ion transmembrane transport] evidence: TAS
GeneID:6233 -> Biological process: GO:0035666 [TRIF-dependent toll-like receptor signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0035872 [nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0038123 [toll-like receptor TLR1:TLR2 signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0038124 [toll-like receptor TLR6:TLR2 signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0042059 [negative regulation of epidermal growth factor receptor signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS
GeneID:6233 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS
GeneID:6233 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: TAS
GeneID:6233 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:6233 -> Biological process: GO:0043123 [positive regulation of I-kappaB kinase/NF-kappaB cascade] evidence: TAS
GeneID:6233 -> Biological process: GO:0044267 [cellular protein metabolic process] evidence: TAS
GeneID:6233 -> Biological process: GO:0045087 [innate immune response] evidence: TAS
GeneID:6233 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: TAS
GeneID:6233 -> Biological process: GO:0046788 [egress of virus within host cell] evidence: TAS
GeneID:6233 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0050852 [T cell receptor signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0051092 [positive regulation of NF-kappaB transcription factor activity] evidence: TAS
GeneID:6233 -> Biological process: GO:0051403 [stress-activated MAPK cascade] evidence: TAS
GeneID:6233 -> Biological process: GO:0051436 [negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:6233 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:6233 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:6233 -> Biological process: GO:0055085 [transmembrane transport] evidence: TAS
GeneID:6233 -> Biological process: GO:0061418 [regulation of transcription from RNA polymerase II promoter in response to hypoxia] evidence: TAS
GeneID:6233 -> Biological process: GO:0070423 [nucleotide-binding oligomerization domain containing signaling pathway] evidence: TAS
GeneID:6233 -> Biological process: GO:0071456 [cellular response to hypoxia] evidence: TAS
GeneID:6233 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: TAS
GeneID:6233 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:6233 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:6233 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
GeneID:6233 -> Cellular component: GO:0010008 [endosome membrane] evidence: TAS
GeneID:6233 -> Cellular component: GO:0015935 [small ribosomal subunit] evidence: IDA
GeneID:6233 -> Cellular component: GO:0022627 [cytosolic small ribosomal subunit] evidence: IDA
GeneID:6233 -> Cellular component: GO:0030666 [endocytic vesicle membrane] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.