Home |
Help |
Advanced search
2024-04-20 12:23:12, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002881 2275 bp mRNA linear PRI 11-JUL-2013
DEFINITION Homo sapiens v-ral simian leukemia viral oncogene homolog B (RALB),
mRNA.
ACCESSION NM_002881
VERSION NM_002881.2 GI:48762927
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2275)
AUTHORS Neyraud,V., Aushev,V.N., Hatzoglou,A., Meunier,B., Cascone,I. and
Camonis,J.
TITLE RalA and RalB proteins are ubiquitinated GTPases, and ubiquitinated
RalA increases lipid raft exposure at the plasma membrane
JOURNAL J. Biol. Chem. 287 (35), 29397-29405 (2012)
PUBMED 22700969
REMARK GeneRIF: the existence of an ubiquitination/de-ubiquitination cycle
superimposed on the GDP/GTP cycle of RalA, involved in the
regulation of RalA activity as well as in membrane raft
trafficking.
REFERENCE 2 (bases 1 to 2275)
AUTHORS Martin,T.D., Mitin,N., Cox,A.D., Yeh,J.J. and Der,C.J.
TITLE Phosphorylation by protein kinase Calpha regulates RalB small
GTPase protein activation, subcellular localization, and effector
utilization
JOURNAL J. Biol. Chem. 287 (18), 14827-14836 (2012)
PUBMED 22393054
REMARK GeneRIF: phosphorylation by PKCalpha is critical for RalB-mediated
vesicle trafficking and exocytosis.
REFERENCE 3 (bases 1 to 2275)
AUTHORS Martin,T.D. and Der,C.J.
TITLE Differential involvement of RalA and RalB in colorectal cancer
JOURNAL Small GTPases 3 (2), 126-130 (2012)
PUBMED 22790202
REMARK GeneRIF: The study found upregulated RalA and RalB activation in
colorectal cancer tumor cell lines and tumors.
REFERENCE 4 (bases 1 to 2275)
AUTHORS Neel,N.F., Rossman,K.L., Martin,T.D., Hayes,T.K., Yeh,J.J. and
Der,C.J.
TITLE The RalB small GTPase mediates formation of invadopodia through a
GTPase-activating protein-independent function of the RalBP1/RLIP76
effector
JOURNAL Mol. Cell. Biol. 32 (8), 1374-1386 (2012)
PUBMED 22331470
REMARK GeneRIF: a novel RalB-mediated biochemical and signaling mechanism
for invadopodium formation
REFERENCE 5 (bases 1 to 2275)
AUTHORS Hazelett,C.C., Sheff,D. and Yeaman,C.
TITLE RalA and RalB differentially regulate development of epithelial
tight junctions
JOURNAL Mol. Biol. Cell 22 (24), 4787-4800 (2011)
PUBMED 22013078
REMARK GeneRIF: RalA and RalB differentially regulate development of
epithelial tight junctions.
REFERENCE 6 (bases 1 to 2275)
AUTHORS Joneson,T. and Bar-Sagi,D.
TITLE Ras effectors and their role in mitogenesis and oncogenesis
JOURNAL J. Mol. Med. 75 (8), 587-593 (1997)
PUBMED 9297626
REMARK Review article
REFERENCE 7 (bases 1 to 2275)
AUTHORS Jilkina,O. and Bhullar,R.P.
TITLE Generation of antibodies specific for the RalA and RalB GTP-binding
proteins and determination of their concentration and distribution
in human platelets
JOURNAL Biochim. Biophys. Acta 1314 (1-2), 157-166 (1996)
PUBMED 8972729
REFERENCE 8 (bases 1 to 2275)
AUTHORS Jullien-Flores,V., Dorseuil,O., Romero,F., Letourneur,F.,
Saragosti,S., Berger,R., Tavitian,A., Gacon,G. and Camonis,J.H.
TITLE Bridging Ral GTPase to Rho pathways. RLIP76, a Ral effector with
CDC42/Rac GTPase-activating protein activity
JOURNAL J. Biol. Chem. 270 (38), 22473-22477 (1995)
PUBMED 7673236
REFERENCE 9 (bases 1 to 2275)
AUTHORS Hsieh,C.L., Swaroop,A. and Francke,U.
TITLE Chromosomal localization and cDNA sequence of human ralB, a GTP
binding protein
JOURNAL Somat. Cell Mol. Genet. 16 (4), 407-410 (1990)
PUBMED 2120779
REFERENCE 10 (bases 1 to 2275)
AUTHORS Chardin,P. and Tavitian,A.
TITLE Coding sequences of human ralA and ralB cDNAs
JOURNAL Nucleic Acids Res. 17 (11), 4380 (1989)
PUBMED 2662142
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BQ893549.1, AK127675.1,
M35416.1 and BC018163.1.
On Jun 16, 2004 this sequence version replaced gi:4506404.
Summary: This gene encodes a GTP-binding protein that belongs to
the small GTPase superfamily and Ras family of proteins.
GTP-binding proteins mediate the transmembrane signaling initiated
by the occupancy of certain cell surface receptors. [provided by
RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC018163.1, M35416.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-29 BQ893549.1 8-36
30-143 AK127675.1 15-128
144-1347 M35416.1 124-1327
1348-2260 AK127675.1 1396-2308
2261-2275 BC018163.1 2166-2180
FEATURES Location/Qualifiers
source 1..2275
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="2"
/map="2q14.2"
gene 1..2275
/gene="RALB"
/note="v-ral simian leukemia viral oncogene homolog B"
/db_xref="GeneID:5899"
/db_xref="HGNC:9840"
/db_xref="HPRD:01550"
/db_xref="MIM:179551"
exon 1..143
/gene="RALB"
/inference="alignment:Splign:1.39.8"
variation 30
/gene="RALB"
/replace="a"
/replace="t"
/db_xref="dbSNP:934722"
variation 105
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:113189263"
exon 144..304
/gene="RALB"
/inference="alignment:Splign:1.39.8"
variation 161
/gene="RALB"
/replace="c"
/replace="t"
/db_xref="dbSNP:368365887"
variation 176
/gene="RALB"
/replace="c"
/replace="g"
/db_xref="dbSNP:371897670"
CDS 191..811
/gene="RALB"
/note="RAS-like protein B; v-ral simian leukemia viral
oncogene homolog B (ras related; GTP binding protein); ras
related GTP binding protein"
/codon_start=1
/product="ras-related protein Ral-B"
/protein_id="NP_002872.1"
/db_xref="GI:4506405"
/db_xref="CCDS:CCDS2131.1"
/db_xref="GeneID:5899"
/db_xref="HGNC:9840"
/db_xref="HPRD:01550"
/db_xref="MIM:179551"
/translation="
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL
"
misc_feature 233..724
/gene="RALB"
/note="Ral (Ras-like) family containing highly homologous
RalA and RalB; Region: RalA_RalB; cd04139"
/db_xref="CDD:206710"
misc_feature 251..274
/gene="RALB"
/note="G1 box; other site"
/db_xref="CDD:206710"
misc_feature order(254..259,398..406,410..415,425..427,434..436,
479..481,485..487,494..499,506..511,518..520)
/gene="RALB"
/note="GDI interaction site; other site"
/db_xref="CDD:206710"
misc_feature order(257..277,305..310,326..328,401..403,572..577,
581..583,662..667)
/gene="RALB"
/note="GTP/Mg2+ binding site [chemical binding]; other
site"
/db_xref="CDD:206710"
misc_feature order(272..277,317..319,323..325,341..346,383..388,
392..394,398..403,668..670)
/gene="RALB"
/note="putative GEF interaction site [polypeptide
binding]; other site"
/db_xref="CDD:206710"
misc_feature order(296..298,302..304,329..346,356..358,368..373,
671..682,686..688)
/gene="RALB"
/note="effector interaction site; other site"
/db_xref="CDD:206710"
misc_feature 317..343
/gene="RALB"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P11234.1);
Region: Effector region (By similarity)"
misc_feature 320..343
/gene="RALB"
/note="Switch I region; other site"
/db_xref="CDD:206710"
misc_feature 326..328
/gene="RALB"
/note="G2 box; other site"
/db_xref="CDD:206710"
misc_feature 392..403
/gene="RALB"
/note="G3 box; other site"
/db_xref="CDD:206710"
misc_feature 398..454
/gene="RALB"
/note="Switch II region; other site"
/db_xref="CDD:206710"
misc_feature 572..583
/gene="RALB"
/note="G4 box; other site"
/db_xref="CDD:206710"
misc_feature order(608..613,620..622,632..634,656..658)
/gene="RALB"
/note="alternate GDI interaction site; other site"
/db_xref="CDD:206710"
misc_feature 662..670
/gene="RALB"
/note="G5 box; other site"
/db_xref="CDD:206710"
misc_feature 797..799
/gene="RALB"
/experiment="experimental evidence, no additional details
recorded"
/note="Cysteine methyl ester; propagated from
UniProtKB/Swiss-Prot (P11234.1); methylation site"
variation 283
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:11545293"
exon 305..513
/gene="RALB"
/inference="alignment:Splign:1.39.8"
variation 415
/gene="RALB"
/replace="c"
/replace="t"
/db_xref="dbSNP:374828155"
variation 449
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:370296136"
variation 460
/gene="RALB"
/replace="a"
/replace="t"
/db_xref="dbSNP:141892771"
variation 473
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:143444584"
variation 506
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:139389446"
exon 514..691
/gene="RALB"
/inference="alignment:Splign:1.39.8"
variation 527
/gene="RALB"
/replace="c"
/replace="t"
/db_xref="dbSNP:1804270"
variation 551..552
/gene="RALB"
/replace=""
/replace="a"
/db_xref="dbSNP:34313338"
variation 563
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:372920618"
variation 565
/gene="RALB"
/replace="c"
/replace="t"
/db_xref="dbSNP:148143386"
variation 584
/gene="RALB"
/replace="c"
/replace="g"
/db_xref="dbSNP:200211173"
variation 587
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:71424343"
variation 594
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:141928830"
variation 644
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:201399252"
variation 652
/gene="RALB"
/replace="c"
/replace="t"
/db_xref="dbSNP:140065337"
variation 667
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:146299608"
variation 673
/gene="RALB"
/replace="c"
/replace="t"
/db_xref="dbSNP:375919427"
variation 682
/gene="RALB"
/replace="c"
/replace="t"
/db_xref="dbSNP:145597965"
variation 689
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:200981856"
variation 691
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:143281479"
exon 692..2261
/gene="RALB"
/inference="alignment:Splign:1.39.8"
variation 778
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:148881695"
variation 808
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:370976845"
variation 812
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:142052645"
variation 851
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:375652851"
variation 857
/gene="RALB"
/replace="c"
/replace="t"
/db_xref="dbSNP:367680205"
variation 932..934
/gene="RALB"
/replace=""
/replace="ctt"
/db_xref="dbSNP:200042107"
variation 946..947
/gene="RALB"
/replace=""
/replace="g"
/db_xref="dbSNP:34085361"
variation 964
/gene="RALB"
/replace="a"
/replace="t"
/db_xref="dbSNP:1065518"
STS 999..1227
/gene="RALB"
/standard_name="RH69131"
/db_xref="UniSTS:4746"
variation 1041
/gene="RALB"
/replace="g"
/replace="t"
/db_xref="dbSNP:11545297"
variation 1115
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:17050087"
variation 1156
/gene="RALB"
/replace="c"
/replace="t"
/db_xref="dbSNP:11545294"
variation 1169
/gene="RALB"
/replace="c"
/replace="t"
/db_xref="dbSNP:193151246"
variation 1170
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:185657383"
variation 1205
/gene="RALB"
/replace="g"
/replace="t"
/db_xref="dbSNP:11545295"
STS 1222..1341
/gene="RALB"
/standard_name="D2S2644"
/db_xref="UniSTS:71948"
variation 1369
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:8706"
variation 1400
/gene="RALB"
/replace="c"
/replace="t"
/db_xref="dbSNP:143192795"
variation 1609
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:188518118"
variation 1700
/gene="RALB"
/replace="c"
/replace="t"
/db_xref="dbSNP:151230692"
variation 1709
/gene="RALB"
/replace="a"
/replace="g"
/db_xref="dbSNP:192006934"
variation 1784
/gene="RALB"
/replace="c"
/replace="t"
/db_xref="dbSNP:375547659"
STS 1948..2225
/gene="RALB"
/standard_name="WI-20388"
/db_xref="UniSTS:19383"
STS 1995..2184
/gene="RALB"
/standard_name="A005V12"
/db_xref="UniSTS:18352"
STS 1995..2184
/gene="RALB"
/standard_name="G20530"
/db_xref="UniSTS:18351"
variation 2089
/gene="RALB"
/replace="c"
/replace="t"
/db_xref="dbSNP:140273894"
variation 2109
/gene="RALB"
/replace="a"
/replace="c"
/db_xref="dbSNP:77826367"
variation 2229..2230
/gene="RALB"
/replace=""
/replace="t"
/db_xref="dbSNP:113673408"
variation 2230..2231
/gene="RALB"
/replace=""
/replace="t"
/db_xref="dbSNP:71761731"
polyA_signal 2240..2245
/gene="RALB"
variation 2241..2242
/gene="RALB"
/replace=""
/replace="t"
/db_xref="dbSNP:202137930"
variation 2243
/gene="RALB"
/replace="a"
/replace="t"
/db_xref="dbSNP:1137385"
ORIGIN
cgctcggggggtgggaaagcgagcccggcagctcaatgacaaatcggtggaggacggctggggtccggccccgggagggggcggggcgcgtttaagagctgcgggccgggtgcggacggcggaggcggcgggactggtccctgctcttcagtgggtcatctgtgtgtcacagcctcagaagaccagcgagatggctgccaacaagagtaagggccagagctccttggccctccacaaggtgatcatggttggcagcggaggcgttggcaagtcagccctgacgcttcagttcatgtatgacgagtttgtagaagactatgaacctaccaaagctgacagttatagaaagaaagtggttcttgatggggaagaagttcagatagatattctggacaccgctgggcaagaggactacgcagccattcgagataactactttcggagtggggaagggtttcttcttgtgttctcaatcacagaacatgaatcctttacagcaactgccgaattcagggaacagattctccgtgtgaaggctgaagaagataaaattccactgctcgtcgtgggaaacaagtctgacctagaggagcggaggcaggtgcctgtggaggaggccaggagtaaagccgaagagtggggcgtgcagtacgtggagacgtcagcgaagacccgggccaacgtggacaaggtgttctttgacctaatgagagaaatcagaacaaagaagatgtcagaaaacaaagacaagaatggcaagaaaagcagcaagaacaagaaaagttttaaagaaagatgttgcttactatgagtgtcaaggtgacggatgaagccagctgctcctaaggacacagggctgggttggtaaagagaaggctatggttgacttcttgcttgtgcttcccactctccccgacttcattcactcaaacttctttaaatggggaaaaatatttgtgactctgtggctggcagaagaaataagcccatgcaagtggaagggctgctttgtcaggaggttgtggaatttctttcttctccccttcttccctcccaaaagcttagctatgtataaagtgccacagataggaaacagctgttaattacaaagagaaagaattgtcatagcatcttattttgttcctagttttataacattaccatccttcgttttgaactacagatgttgtagtgggttttggaggagggagtggagtaagatgccctcccacttttatcagtttagtagtagtactgagaaaaatcccttcagctctaagaacactgaaaaatccaccgattttttgggtaagcttcttggcaataccctgtggatctgaaacagctaaaaaaatgaatttgaattgcgccagataggtcaataccaagcttctgattcctcctcacatatgaaaagtgaaagttgtgagttgttttcctcttatttaaacattggcctattataatctgtgttggttatttttctcctgtaagcatcctgatttttctgtaggaacttttctttggcagaccaagtgaagactcaggaatggtgtgcattataaatgacacacattgccacttgtgtagatatttttaagttctttggctaagtcctctcctaactgcctgtcctctggttaggcccctccctctccactagtggtgaatgcatgtgtctgtctgatcagcatcactgcacacggaggtctagtgagcctcttgctaagtgtcacacacactcttcccaaagacgtgatgagttaaagttgtattctgaaatcatgaagccagagcctgtgccagaccttctgctacctctcatagaattgctctgtaattctaaatttaaaattagaagtagagagagataagccatcgcccctttgcctctgagaattggctgctgtttctaatataattattttctaagatagccagatagttagaaaaagattttcattgatgacatatctttaaactttcttgcatcagtattctaaattgagcaaactgaaagattttcatcaggaaaggagcactgtgggaagagcccagtattcacattttttccccatttttcagaagcgacatttcatatataggtgccaaaagtgaatcggggtgcggagagtgggaaccttttgaatttatgattgtcacagagatggtagaaattatgatctgactggaaaacaatcctgtatcccctcccaaagaatcatgggctttttttttgaataaaaaagcagacaaatagaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:5899 -> Molecular function: GO:0003924 [GTPase activity] evidence: IDA
GeneID:5899 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:5899 -> Molecular function: GO:0005525 [GTP binding] evidence: IDA
GeneID:5899 -> Biological process: GO:0000910 [cytokinesis] evidence: IDA
GeneID:5899 -> Biological process: GO:0001928 [regulation of exocyst assembly] evidence: ISS
GeneID:5899 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:5899 -> Biological process: GO:0007165 [signal transduction] evidence: TAS
GeneID:5899 -> Biological process: GO:0007265 [Ras protein signal transduction] evidence: TAS
GeneID:5899 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS
GeneID:5899 -> Biological process: GO:0060178 [regulation of exocyst localization] evidence: ISS
GeneID:5899 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA
GeneID:5899 -> Cellular component: GO:0030496 [midbody] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.