GGRNA Home | Help | Advanced search

2024-03-29 09:59:33, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_002825               1558 bp    mRNA    linear   PRI 24-JUN-2013
DEFINITION  Homo sapiens pleiotrophin (PTN), mRNA.
ACCESSION   NM_002825
VERSION     NM_002825.5  GI:42476152
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1558)
  AUTHORS   Zhang,Q., Tao,K., Huang,W., Tian,Y. and Liu,X.
  TITLE     Elevated expression of pleiotrophin in human hypertrophic scars
  JOURNAL   J. Mol. Histol. 44 (1), 91-96 (2013)
   PUBMED   23054143
  REMARK    GeneRIF: elevated expression of PTN is likely to be involved in the
            pathogenesis of hypertrophic scar (HS).
REFERENCE   2  (bases 1 to 1558)
  AUTHORS   Singh,P.K. and Srivastava,V.
  TITLE     Recombinant expression and purification of heparin binding
            proteins: midkine and pleiotrophin from Escherichia coli
  JOURNAL   Protein Expr. Purif. 85 (2), 181-186 (2012)
   PUBMED   22871361
  REMARK    GeneRIF: Soluble rhMDK, rmMDK and rhPTN were expressed at a
            high-level and the protein was purified by a one-step purification
            using heparin affinity chromatography. Activity of purified rhMDK
            and rhPTN was confirmed by a cell proliferation assay.
REFERENCE   3  (bases 1 to 1558)
  AUTHORS   Tsirmoula,S., Dimas,K., Hatziapostolou,M., Lamprou,M., Ravazoula,P.
            and Papadimitriou,E.
  TITLE     Implications of pleiotrophin in human PC3 prostate cancer cell
            growth in vivo
  JOURNAL   Cancer Sci. 103 (10), 1826-1832 (2012)
   PUBMED   22783964
  REMARK    GeneRIF: Our data suggest that PTN is implicated in human prostate
            cancer growth in vivo
REFERENCE   4  (bases 1 to 1558)
  AUTHORS   Sethi,G., Pathak,H.B., Zhang,H., Zhou,Y., Einarson,M.B.,
            Vathipadiekal,V., Gunewardena,S., Birrer,M.J. and Godwin,A.K.
  TITLE     An RNA interference lethality screen of the human druggable genome
            to identify molecular vulnerabilities in epithelial ovarian cancer
  JOURNAL   PLoS ONE 7 (10), E47086 (2012)
   PUBMED   23056589
  REMARK    GeneRIF: NDC80, NUF2 and PTN were significantly aberrantly
            overexpressed in serous adenocarcinomas.
REFERENCE   5  (bases 1 to 1558)
  AUTHORS   Lau,F.H., Xia,F., Kaplan,A., Cerrato,F., Greene,A.K., Taghinia,A.,
            Cowan,C.A. and Labow,B.I.
  TITLE     Expression analysis of macrodactyly identifies pleiotrophin
            upregulation
  JOURNAL   PLoS ONE 7 (7), E40423 (2012)
   PUBMED   22848377
  REMARK    GeneRIF: pleiotrophin (PTN) was significantly overexpressed across
            all our macrodactyly samples. The mitogenic functions of PTN
            correlate closely with the clinical characteristics of
            macrodactyly.
REFERENCE   6  (bases 1 to 1558)
  AUTHORS   Li,Y.S., Hoffman,R.M., Le Beau,M.M., Espinosa,R. III, Jenkins,N.A.,
            Gilbert,D.J., Copeland,N.G. and Deuel,T.F.
  TITLE     Characterization of the human pleiotrophin gene. Promoter region
            and chromosomal localization
  JOURNAL   J. Biol. Chem. 267 (36), 26011-26016 (1992)
   PUBMED   1464612
REFERENCE   7  (bases 1 to 1558)
  AUTHORS   Milner,P.G., Shah,D., Veile,R., Donis-Keller,H. and Kumar,B.V.
  TITLE     Cloning, nucleotide sequence, and chromosome localization of the
            human pleiotrophin gene
  JOURNAL   Biochemistry 31 (48), 12023-12028 (1992)
   PUBMED   1457401
REFERENCE   8  (bases 1 to 1558)
  AUTHORS   Wellstein,A., Fang,W.J., Khatri,A., Lu,Y., Swain,S.S.,
            Dickson,R.B., Sasse,J., Riegel,A.T. and Lippman,M.E.
  TITLE     A heparin-binding growth factor secreted from breast cancer cells
            homologous to a developmentally regulated cytokine
  JOURNAL   J. Biol. Chem. 267 (4), 2582-2587 (1992)
   PUBMED   1733956
REFERENCE   9  (bases 1 to 1558)
  AUTHORS   Kretschmer,P.J., Fairhurst,J.L., Decker,M.M., Chan,C.P.,
            Gluzman,Y., Bohlen,P. and Kovesdi,I.
  TITLE     Cloning, characterization and developmental regulation of two
            members of a novel human gene family of neurite outgrowth-promoting
            proteins
  JOURNAL   Growth Factors 5 (2), 99-114 (1991)
   PUBMED   1768439
REFERENCE   10 (bases 1 to 1558)
  AUTHORS   Tezuka,K., Takeshita,S., Hakeda,Y., Kumegawa,M., Kikuno,R. and
            Hashimoto-Gotoh,T.
  TITLE     Isolation of mouse and human cDNA clones encoding a protein
            expressed specifically in osteoblasts and brain tissues
  JOURNAL   Biochem. Biophys. Res. Commun. 173 (1), 246-251 (1990)
   PUBMED   1701634
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            M57399.1, BC005916.1 and BM968820.1.
            On Feb 9, 2004 this sequence version replaced gi:31543448.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC005916.1, AL535180.3 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-12                M57399.1           33-44
            13-1287             BC005916.1         1-1275
            1288-1558           BM968820.1         1-271               c
FEATURES             Location/Qualifiers
     source          1..1558
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="7"
                     /map="7q33"
     gene            1..1558
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /note="pleiotrophin"
                     /db_xref="GeneID:5764"
                     /db_xref="HGNC:9630"
                     /db_xref="HPRD:01199"
                     /db_xref="MIM:162095"
     exon            1..362
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    106..108
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /note="upstream in-frame stop codon"
     variation       309
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:11539934"
     exon            363..478
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /inference="alignment:Splign:1.39.8"
     CDS             364..870
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /note="heparin affin regulatory protein; heparin-binding
                     growth-associated molecule; pleiotrophin (heparin binding
                     growth factor 8, neurite growth-promoting factor 1); HBBM;
                     OSF-1; HB-GAM; HBGF-8; HBNF-1; osteoblast-specific factor
                     1; heparin-binding brain mitogen; heparin-binding growth
                     factor 8; heparin-binding neurite outgrowth-promoting
                     factor 1"
                     /codon_start=1
                     /product="pleiotrophin precursor"
                     /protein_id="NP_002816.1"
                     /db_xref="GI:4506281"
                     /db_xref="CCDS:CCDS5844.1"
                     /db_xref="GeneID:5764"
                     /db_xref="HGNC:9630"
                     /db_xref="HPRD:01199"
                     /db_xref="MIM:162095"
                     /translation="
MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
"
     sig_peptide     364..459
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     mat_peptide     460..867
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /product="Pleiotrophin"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P21246.1)"
     misc_feature    502..756
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /note="Pleiotrophin / midkine family; Region: PTN;
                     smart00193"
                     /db_xref="CDD:128490"
     misc_feature    order(502..504,589..591)
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="disulfide bridge bond"
     misc_feature    order(526..528,616..618)
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="disulfide bridge bond"
     misc_feature    order(547..549,628..630)
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="disulfide bridge bond"
     misc_feature    order(658..660,754..756)
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="disulfide bridge bond"
     misc_feature    order(688..690,784..786)
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="disulfide bridge bond"
     exon            479..652
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /inference="alignment:Splign:1.39.8"
     exon            653..814
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /inference="alignment:Splign:1.39.8"
     exon            815..1549
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /inference="alignment:Splign:1.39.8"
     STS             876..965
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /standard_name="D7S2735"
                     /db_xref="UniSTS:56879"
     STS             894..1061
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /standard_name="Ptn"
                     /db_xref="UniSTS:144298"
     STS             1326..1519
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /standard_name="A005E25"
                     /db_xref="UniSTS:66842"
     STS             1374..1473
                     /gene="PTN"
                     /gene_synonym="HARP; HBGF8; HBNF; NEGF1"
                     /standard_name="STS-AA001449"
                     /db_xref="UniSTS:7028"
ORIGIN      
gagtgcaaagcgctctccctccctcgcccagccttcgtcctcctggcccgctcctctcatccctcccattctccatttcccttccgttccctccctgtcagggcgtaattgagtcaaaggcaggatcaggttccccgccttccagtccaaaaatcccgccaagagagccccagagcagaggaaaatccaaagtggagagaggggaagaaagagaccagtgagtcatccgtccagaaggcggggagagcagcagcggcccaagcaggagctgcagcgagccgggtacctggactcagcggtagcaacctcgccccttgcaacaaaggcagactgagcgccagagaggacgtttccaactcaaaaatgcaggctcaacagtaccagcagcagcgtcgaaaatttgcagctgccttcttggcattcattttcatactggcagctgtggatactgctgaagcagggaagaaagagaaaccagaaaaaaaagtgaagaagtctgactgtggagaatggcagtggagtgtgtgtgtgcccaccagtggagactgtgggctgggcacacgggagggcactcggactggagctgagtgcaagcaaaccatgaagacccagagatgtaagatcccctgcaactggaagaagcaatttggcgcggagtgcaaataccagttccaggcctggggagaatgtgacctgaacacagccctgaagaccagaactggaagtctgaagcgagccctgcacaatgccgaatgccagaagactgtcaccatctccaagccctgtggcaaactgaccaagcccaaacctcaagcagaatctaagaagaagaaaaaggaaggcaagaaacaggagaagatgctggattaaaagatgtcacctgtggaacataaaaaggacatcagcaaacaggatcagttaactattgcatttatatgtaccgtaggctttgtattcaaaaattatctatagctaagtacacaataagcaaaaacaaaaagaaaagaaaatttttgtagtagcgttttttaaatgtatactatagtaccagtaggggcttataataaaggactgtaatcttatttaggaagttgacttatagtacatgataaatgatagacaattgaggtaagttttttgaaattatgtgacattttacattaaattttttttacattttttgggcagcaatttaaatgttatgactatgtaaactacttctcttgttaggtaatttttttcacctagatttttttcccaattgagaaaaatatatactaaacaaaatagcaataaaacataatcactctatttgaagaaaatatcttgttttctgccaatagattttttaaaatgtagtcagcaaaatgggggtggggaagcagagcatgtcctagttcaatgttgactttttttttttttaaagaaaagcattaagacataaaattctttcactttggcagaagcatttgttttcttgatgaaattatttttccatctgaggaaaaaaatactaggaaaataaatcaaggtgatgctgaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:5764 -> Molecular function: GO:0004864 [protein phosphatase inhibitor activity] evidence: TAS
            GeneID:5764 -> Molecular function: GO:0008083 [growth factor activity] evidence: IEA
            GeneID:5764 -> Molecular function: GO:0008201 [heparin binding] evidence: IEA
            GeneID:5764 -> Biological process: GO:0007185 [transmembrane receptor protein tyrosine phosphatase signaling pathway] evidence: TAS
            GeneID:5764 -> Biological process: GO:0007399 [nervous system development] evidence: TAS
            GeneID:5764 -> Biological process: GO:0007612 [learning] evidence: IEA
            GeneID:5764 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: TAS
            GeneID:5764 -> Biological process: GO:0030282 [bone mineralization] evidence: IEA
            GeneID:5764 -> Biological process: GO:0051781 [positive regulation of cell division] evidence: IEA
            GeneID:5764 -> Cellular component: GO:0005615 [extracellular space] evidence: TAS
            GeneID:5764 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.