Home |
Help |
Advanced search
2024-04-27 08:04:17, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002800 1048 bp mRNA linear PRI 15-JUN-2013
DEFINITION Homo sapiens proteasome (prosome, macropain) subunit, beta type, 9
(PSMB9), mRNA.
ACCESSION NM_002800
VERSION NM_002800.4 GI:73747923
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1048)
AUTHORS Williams,F.M., Bansal,A.T., van Meurs,J.B., Bell,J.T.,
Meulenbelt,I., Suri,P., Rivadeneira,F., Sambrook,P.N., Hofman,A.,
Bierma-Zeinstra,S., Menni,C., Kloppenburg,M., Slagboom,P.E.,
Hunter,D.J., Macgregor,A.J., Uitterlinden,A.G. and Spector,T.D.
TITLE Novel genetic variants associated with lumbar disc degeneration in
northern Europeans: a meta-analysis of 4600 subjects
JOURNAL Ann. Rheum. Dis. 72 (7), 1141-1148 (2013)
PUBMED 22993228
REFERENCE 2 (bases 1 to 1048)
AUTHORS Yamazaki,K., Umeno,J., Takahashi,A., Hirano,A., Johnson,T.A.,
Kumasaka,N., Morizono,T., Hosono,N., Kawaguchi,T., Takazoe,M.,
Yamada,T., Suzuki,Y., Tanaka,H., Motoya,S., Hosokawa,M.,
Arimura,Y., Shinomura,Y., Matsui,T., Matsumoto,T., Iida,M.,
Tsunoda,T., Nakamura,Y., Kamatani,N. and Kubo,M.
TITLE A genome-wide association study identifies 2 susceptibility Loci
for Crohn's disease in a Japanese population
JOURNAL Gastroenterology 144 (4), 781-788 (2013)
PUBMED 23266558
REFERENCE 3 (bases 1 to 1048)
AUTHORS Zheng,G., Chaux,A., Sharma,R., Netto,G. and Caturegli,P.
TITLE LMP2, a novel immunohistochemical marker to distinguish renal
oncocytoma from the eosinophilic variant of chromophobe renal cell
carcinoma
JOURNAL Exp. Mol. Pathol. 94 (1), 29-32 (2013)
PUBMED 22705098
REMARK GeneRIF: study reports expression of LMP2 in patients with renal
oncocytomas (RO) and eosinophilic variant of chromophobe renal cell
carcinomas (CHRCC-EO); all CHRCC-EO cases (7 of 7) strongly showed
nuclear LMP2 staining, as opposed to only 2 of 56 ROs; suggest its
use as an aid in differential diagnosis of these neoplasias
REFERENCE 4 (bases 1 to 1048)
AUTHORS Lichter,D.I., Danaee,H., Pickard,M.D., Tayber,O., Sintchak,M.,
Shi,H., Richardson,P.G., Cavenagh,J., Blade,J., Facon,T.,
Niesvizky,R., Alsina,M., Dalton,W., Sonneveld,P., Lonial,S., van de
Velde,H., Ricci,D., Esseltine,D.L., Trepicchio,W.L., Mulligan,G.
and Anderson,K.C.
TITLE Sequence analysis of beta-subunit genes of the 20S proteasome in
patients with relapsed multiple myeloma treated with bortezomib or
dexamethasone
JOURNAL Blood 120 (23), 4513-4516 (2012)
PUBMED 23018640
REMARK GeneRIF: Data indicate that treatment-emergent resistance to
single-agent bortezomib was independent of variants in the
proteasome genes PSMB1, PSMB5, PSMB6, PSMB8, PSMB9, and PSMB10.
REFERENCE 5 (bases 1 to 1048)
AUTHORS Guillaume,B., Stroobant,V., Bousquet-Dubouch,M.P., Colau,D.,
Chapiro,J., Parmentier,N., Dalet,A. and Van den Eynde,B.J.
TITLE Analysis of the processing of seven human tumor antigens by
intermediate proteasomes
JOURNAL J. Immunol. 189 (7), 3538-3547 (2012)
PUBMED 22925930
REMARK GeneRIF: The MAGE-C(2336-344) antigenic peptide is produced by the
immunoproteasome and intermediate proteasome beta1i-beta5i, but not
by the standard proteasome nor intermediate proteasome beta5i.
REFERENCE 6 (bases 1 to 1048)
AUTHORS Kristensen,P., Johnsen,A.H., Uerkvitz,W., Tanaka,K. and Hendil,K.B.
TITLE Human proteasome subunits from 2-dimensional gels identified by
partial sequencing
JOURNAL Biochem. Biophys. Res. Commun. 205 (3), 1785-1789 (1994)
PUBMED 7811265
REMARK Erratum:[Biochem Biophys Res Commun. 1995 Feb 27;207(3):1059. PMID:
7864893]
REFERENCE 7 (bases 1 to 1048)
AUTHORS Beck,S., Kelly,A., Radley,E., Khurshid,F., Alderton,R.P. and
Trowsdale,J.
TITLE DNA sequence analysis of 66 kb of the human MHC class II region
encoding a cluster of genes for antigen processing
JOURNAL J. Mol. Biol. 228 (2), 433-441 (1992)
PUBMED 1453454
REFERENCE 8 (bases 1 to 1048)
AUTHORS Fruh,K., Yang,Y., Arnold,D., Chambers,J., Wu,L., Waters,J.B.,
Spies,T. and Peterson,P.A.
TITLE Alternative exon usage and processing of the major
histocompatibility complex-encoded proteasome subunits
JOURNAL J. Biol. Chem. 267 (31), 22131-22140 (1992)
PUBMED 1429565
REFERENCE 9 (bases 1 to 1048)
AUTHORS Kelly,A., Powis,S.H., Glynne,R., Radley,E., Beck,S. and
Trowsdale,J.
TITLE Second proteasome-related gene in the human MHC class II region
JOURNAL Nature 353 (6345), 667-668 (1991)
PUBMED 1922385
REFERENCE 10 (bases 1 to 1048)
AUTHORS Martinez,C.K. and Monaco,J.J.
TITLE Homology of proteasome subunits to a major histocompatibility
complex-linked LMP gene
JOURNAL Nature 353 (6345), 664-667 (1991)
PUBMED 1681432
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BF513693.1, BC065513.1 and
AI310206.1.
On Aug 24, 2005 this sequence version replaced gi:23110930.
Summary: The proteasome is a multicatalytic proteinase complex with
a highly ordered ring-shaped 20S core structure. The core structure
is composed of 4 rings of 28 non-identical subunits; 2 rings are
composed of 7 alpha subunits and 2 rings are composed of 7 beta
subunits. Proteasomes are distributed throughout eukaryotic cells
at a high concentration and cleave peptides in an
ATP/ubiquitin-dependent process in a non-lysosomal pathway. An
essential function of a modified proteasome, the immunoproteasome,
is the processing of class I MHC peptides. This gene encodes a
member of the proteasome B-type family, also known as the T1B
family, that is a 20S core beta subunit. This gene is located in
the class II region of the MHC (major histocompatibility complex).
Expression of this gene is induced by gamma interferon and this
gene product replaces catalytic subunit 1 (proteasome beta 6
subunit) in the immunoproteasome. Proteolytic processing is
required to generate a mature subunit. [provided by RefSeq, Mar
2010].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BQ706947.1, BQ947748.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-45 BF513693.1 322-366
46-782 BC065513.1 1-737
783-1048 AI310206.1 4-269 c
FEATURES Location/Qualifiers
source 1..1048
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="6"
/map="6p21.3"
gene 1..1048
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/note="proteasome (prosome, macropain) subunit, beta type,
9"
/db_xref="GeneID:5698"
/db_xref="HGNC:9546"
/db_xref="HPRD:01514"
/db_xref="MIM:177045"
exon 1..129
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/inference="alignment:Splign:1.39.8"
variation 42
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:116182120"
variation 65
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:111585165"
CDS 70..729
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/EC_number="3.4.25.1"
/note="proteasome-related gene 2; proteasome chain 7;
macropain chain 7; low molecular mass protein 2;
multicatalytic endopeptidase complex chain 7; proteasome
catalytic subunit 1i; proteasome subunit beta 6i;
proteasome subunit beta type-9; proteasome subunit
beta-1i; really interesting new gene 12 protein;
proteasome (prosome, macropain) subunit, beta type, 9
(large multifunctional peptidase 2)"
/codon_start=1
/product="proteasome subunit beta type-9 proprotein"
/protein_id="NP_002791.1"
/db_xref="GI:4506205"
/db_xref="CCDS:CCDS4759.1"
/db_xref="GeneID:5698"
/db_xref="HGNC:9546"
/db_xref="HPRD:01514"
/db_xref="MIM:177045"
/translation="
MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
"
misc_feature 97..726
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/note="20S proteasome, alpha and beta subunits
[Posttranslational modification, protein turnover,
chaperones]; Region: PRE1; COG0638"
/db_xref="CDD:30983"
misc_feature 127..132
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/experiment="experimental evidence, no additional details
recorded"
/note="Cleavage, by autocatalysis; propagated from
UniProtKB/Swiss-Prot (P28065.2); cleavage site"
mat_peptide 130..726
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/product="proteasome subunit beta type-9"
misc_feature 130..690
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/note="proteasome beta type-6 subunit. The 20S proteasome,
multisubunit proteolytic complex, is the central enzyme of
nonlysosomal protein degradation in both the cytosol and
nucleus. It is composed of 28 subunits arranged as four
homoheptameric rings that...; Region:
proteasome_beta_type_6; cd03762"
/db_xref="CDD:48460"
misc_feature order(130..132,178..180,184..186,226..228,514..516,
625..627,634..639)
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/note="active site"
/db_xref="CDD:48460"
misc_feature order(184..186,193..195,199..216,274..276,280..282,
325..327,361..363,370..375,379..384,391..393,400..402,
469..471,475..477,481..492,499..501,523..528,532..537,
544..552,598..600,619..630,637..642)
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/note="beta subunit interaction site [polypeptide
binding]; other site"
/db_xref="CDD:48460"
misc_feature 226..228
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P28065.2); acetylation site"
misc_feature 394..396
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P28065.2); acetylation site"
variation 95
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:35100697"
variation 97
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:368807805"
exon 130..197
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/inference="alignment:Splign:1.39.8"
variation 157
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:375222612"
variation 163
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:241419"
variation 192
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="g"
/replace="t"
/db_xref="dbSNP:146971552"
exon 198..329
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/inference="alignment:Splign:1.39.8"
variation 214
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:138104453"
variation 216
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="c"
/db_xref="dbSNP:55676030"
variation 245
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:77306928"
variation 247
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:145067819"
variation 248
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:17587"
variation 259
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="g"
/replace="t"
/db_xref="dbSNP:148307794"
variation 298
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:200828307"
variation 302
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:141395015"
variation 321
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:367832713"
exon 330..459
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/inference="alignment:Splign:1.39.8"
variation 332
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:55697508"
variation 340
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:373560016"
variation 400
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="c"
/db_xref="dbSNP:367733308"
variation 401
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:150909909"
variation 446
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:56239515"
variation 447
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="t"
/db_xref="dbSNP:372201131"
exon 460..601
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/inference="alignment:Splign:1.39.8"
variation 473
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:372026084"
variation 490
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:138300421"
variation 522
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:377722149"
variation 532
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:142964194"
variation 538
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:374928062"
variation 552
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:20547"
variation 555
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:182700479"
variation 563
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:369359789"
variation 586
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:17213861"
variation 587
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:142488085"
exon 602..1048
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/inference="alignment:Splign:1.39.8"
variation 617
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:369986248"
variation 637
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:373167013"
variation 639
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:145965388"
variation 672
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:373371271"
variation 716..717
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace=""
/replace="g"
/db_xref="dbSNP:34848448"
variation 721
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="g"
/db_xref="dbSNP:148645171"
variation 748
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="g"
/replace="t"
/db_xref="dbSNP:369568221"
polyA_signal 761..766
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
variation 770
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:372941672"
variation 774
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:201336055"
variation 776
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:241418"
polyA_site 782
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/experiment="experimental evidence, no additional details
recorded"
variation 784..785
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace=""
/replace="ta"
/db_xref="dbSNP:142449082"
variation 825
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="c"
/db_xref="dbSNP:112499843"
variation 909
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:141148538"
variation 928
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:56362395"
variation 967
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:189984229"
variation 981..985
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace=""
/replace="aa"
/replace="aag"
/db_xref="dbSNP:9280201"
variation 981..985
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace=""
/replace="aag"
/replace="gaa"
/db_xref="dbSNP:67314040"
variation 983
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="t"
/db_xref="dbSNP:200222533"
variation 985..986
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace=""
/replace="aag"
/db_xref="dbSNP:55975140"
variation 1013
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:112040195"
variation 1014
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="g"
/db_xref="dbSNP:376797982"
variation 1017
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="a"
/replace="t"
/db_xref="dbSNP:371111752"
variation 1044
/gene="PSMB9"
/gene_synonym="beta1i; LMP2; PSMB6i; RING12"
/replace="c"
/replace="t"
/db_xref="dbSNP:182646255"
ORIGIN
gcgcgttgtgcgctgtcccaggttggaaaccagtgccccaggcggcgaggagagcggtgccttgcagggatgctgcgggcgggagcaccaaccggggacttaccccgggcgggagaagtccacaccgggaccaccatcatggcagtggagtttgacgggggcgttgtgatgggttctgattcccgagtgtctgcaggcgaggcggtggtgaaccgagtgtttgacaagctgtccccgctgcacgagcgcatctactgtgcactctctggttcagctgctgatgcccaagccgtggccgacatggccgcctaccagctggagctccatgggatagaactggaggaacctccacttgttttggctgctgcaaatgtggtgagaaatatcagctataaatatcgagaggacttgtctgcacatctcatggtagctggctgggaccaacgtgaaggaggtcaggtatatggaaccctgggaggaatgctgactcgacagccttttgccattggtggctccggcagcacctttatctatggttatgtggatgcagcatataagccaggcatgtctcccgaggagtgcaggcgcttcaccacagacgctattgctctggccatgagccgggatggctcaagcgggggtgtcatctacctggtcactattacagctgccggtgtggaccatcgagtcatcttgggcaatgaactgccaaaattctatgatgagtgaaccttccccagacttctctttcttattttgtaataaactctctagggccaaaacctggtatggtcattgggaaatgagtgctcagggagatggagcttaggggaggtgggtgcttccctcctagatgtcagcatacactctttcttcttttgtcccaggtctaaaacatctttcctagagaaaacaaaagggactaaactagaaatataaagagccctatacatgacaggtgatcacgtactgaatgattttgaagtagtacaaacaataaaaattctcattccgcatcatcatgcggtccatgatgatgaggccgcaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:5698 -> Molecular function: GO:0004298 [threonine-type endopeptidase activity] evidence: IEA
GeneID:5698 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:5698 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS
GeneID:5698 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: TAS
GeneID:5698 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:5698 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS
GeneID:5698 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS
GeneID:5698 -> Biological process: GO:0006521 [regulation of cellular amino acid metabolic process] evidence: TAS
GeneID:5698 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:5698 -> Biological process: GO:0006977 [DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest] evidence: TAS
GeneID:5698 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:5698 -> Biological process: GO:0016032 [viral process] evidence: TAS
GeneID:5698 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS
GeneID:5698 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS
GeneID:5698 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
GeneID:5698 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS
GeneID:5698 -> Biological process: GO:0034641 [cellular nitrogen compound metabolic process] evidence: TAS
GeneID:5698 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS
GeneID:5698 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS
GeneID:5698 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:5698 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
GeneID:5698 -> Biological process: GO:0051436 [negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5698 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5698 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5698 -> Cellular component: GO:0000502 [proteasome complex] evidence: TAS
GeneID:5698 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:5698 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:5698 -> Cellular component: GO:0005839 [proteasome core complex] evidence: ISS
GeneID:5698 -> Cellular component: GO:1990111 [spermatoproteasome complex] evidence: ISS
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_002791 -> EC 3.4.25.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.