Home |
Help |
Advanced search
2024-04-23 22:50:02, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002799 1043 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens proteasome (prosome, macropain) subunit, beta type, 7
(PSMB7), mRNA.
ACCESSION NM_002799
VERSION NM_002799.3 GI:394025664
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1043)
AUTHORS Krawiec,P., Gluszko,P., Kwasny-Krochin,B. and Undas,A.
TITLE Decreased proteinZ levels in patients with rheumatoid arthritis:
links with inflammation
JOURNAL Thromb. Haemost. 106 (3), 548-550 (2011)
PUBMED 21713324
REMARK GeneRIF: reduced protein levels in patients with rheumatoid
arthritis in association with disease progression
REFERENCE 2 (bases 1 to 1043)
AUTHORS Li,J., Liu,F., Wang,H., Liu,X., Liu,J., Li,N., Wan,F., Wang,W.,
Zhang,C., Jin,S., Liu,J., Zhu,P. and Liu,Y.
TITLE Systematic mapping and functional analysis of a family of human
epididymal secretory sperm-located proteins
JOURNAL Mol. Cell Proteomics 9 (11), 2517-2528 (2010)
PUBMED 20736409
REFERENCE 3 (bases 1 to 1043)
AUTHORS Munkacsy,G., Abdul-Ghani,R., Mihaly,Z., Tegze,B., Tchernitsa,O.,
Surowiak,P., Schafer,R. and Gyorffy,B.
TITLE PSMB7 is associated with anthracycline resistance and is a
prognostic biomarker in breast cancer
JOURNAL Br. J. Cancer 102 (2), 361-368 (2010)
PUBMED 20010949
REMARK GeneRIF: high PSMB7 expression is associated with anthracycline
resistance in breast cancer.
REFERENCE 4 (bases 1 to 1043)
AUTHORS Eang,R., Girbal-Neuhauser,E., Xu,B. and Gairin,J.E.
TITLE Characterization and differential expression of a newly identified
phosphorylated isoform of the human 20S proteasome beta7 subunit in
tumor vs. normal cell lines
JOURNAL Fundam Clin Pharmacol 23 (2), 215-224 (2009)
PUBMED 19645816
REMARK GeneRIF: we have identified and characterized a new phosphorylated
isoform of the human 20S proteasome b7 subunit and showed its
differential expression in tumor vs. normal cell lines
REFERENCE 5 (bases 1 to 1043)
AUTHORS Huang,X., Swanson,R., Broze,G.J. Jr. and Olson,S.T.
TITLE Kinetic characterization of the protein Z-dependent protease
inhibitor reaction with blood coagulation factor Xa
JOURNAL J. Biol. Chem. 283 (44), 29770-29783 (2008)
PUBMED 18768472
REMARK GeneRIF: ZPI functions like other serpins to regulate the activity
of FXa but in a manner uniquely dependent on protein Z,
procoagulant membranes, and pH
REFERENCE 6 (bases 1 to 1043)
AUTHORS Madani,N. and Kabat,D.
TITLE An endogenous inhibitor of human immunodeficiency virus in human
lymphocytes is overcome by the viral Vif protein
JOURNAL J. Virol. 72 (12), 10251-10255 (1998)
PUBMED 9811770
REFERENCE 7 (bases 1 to 1043)
AUTHORS Seeger,M., Ferrell,K., Frank,R. and Dubiel,W.
TITLE HIV-1 tat inhibits the 20 S proteasome and its 11 S
regulator-mediated activation
JOURNAL J. Biol. Chem. 272 (13), 8145-8148 (1997)
PUBMED 9079628
REFERENCE 8 (bases 1 to 1043)
AUTHORS Hisamatsu,H., Shimbara,N., Saito,Y., Kristensen,P., Hendil,K.B.,
Fujiwara,T., Takahashi,E., Tanahashi,N., Tamura,T., Ichihara,A. and
Tanaka,K.
TITLE Newly identified pair of proteasomal subunits regulated
reciprocally by interferon gamma
JOURNAL J. Exp. Med. 183 (4), 1807-1816 (1996)
PUBMED 8666937
REFERENCE 9 (bases 1 to 1043)
AUTHORS Coux,O., Tanaka,K. and Goldberg,A.L.
TITLE Structure and functions of the 20S and 26S proteasomes
JOURNAL Annu. Rev. Biochem. 65, 801-847 (1996)
PUBMED 8811196
REMARK Review article
REFERENCE 10 (bases 1 to 1043)
AUTHORS Kristensen,P., Johnsen,A.H., Uerkvitz,W., Tanaka,K. and Hendil,K.B.
TITLE Human proteasome subunits from 2-dimensional gels identified by
partial sequencing
JOURNAL Biochem. Biophys. Res. Commun. 205 (3), 1785-1789 (1994)
PUBMED 7811265
REMARK Erratum:[Biochem Biophys Res Commun. 1995 Feb 27;207(3):1059. PMID:
7864893]
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AK308756.1 and GU727627.1.
On Jul 7, 2012 this sequence version replaced gi:23110926.
Summary: The proteasome is a multicatalytic proteinase complex with
a highly ordered ring-shaped 20S core structure. The core structure
is composed of 4 rings of 28 non-identical subunits; 2 rings are
composed of 7 alpha subunits and 2 rings are composed of 7 beta
subunits. Proteasomes are distributed throughout eukaryotic cells
at a high concentration and cleave peptides in an
ATP/ubiquitin-dependent process in a non-lysosomal pathway. The
encoded protein is a member of the proteasome B-type family, also
known as the T1B family, and is a 20S core beta subunit in the
proteasome. Expression of this catalytic subunit is downregulated
by gamma interferon, and proteolytic processing is required to
generate a mature subunit. A pseudogene of this gene is located on
the long arm of chromosome 14. [provided by RefSeq, Jul 2012].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: GU727627.1, BC008414.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-31 AK308756.1 1-31
32-1043 GU727627.1 1-1012
FEATURES Location/Qualifiers
source 1..1043
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="9"
/map="9q34.11-q34.12"
gene 1..1043
/gene="PSMB7"
/gene_synonym="Z"
/note="proteasome (prosome, macropain) subunit, beta type,
7"
/db_xref="GeneID:5695"
/db_xref="HGNC:9544"
/db_xref="HPRD:04940"
/db_xref="MIM:604030"
exon 1..110
/gene="PSMB7"
/gene_synonym="Z"
/inference="alignment:Splign:1.39.8"
CDS 49..882
/gene="PSMB7"
/gene_synonym="Z"
/EC_number="3.4.25.1"
/note="proteasome catalytic subunit 2; macropain chain Z;
proteasome subunit alpha; multicatalytic endopeptidase
complex chain Z; proteasome subunit Z; proteasome subunit
beta type-7"
/codon_start=1
/product="proteasome subunit beta type-7 proprotein"
/protein_id="NP_002790.1"
/db_xref="GI:4506203"
/db_xref="CCDS:CCDS6855.1"
/db_xref="GeneID:5695"
/db_xref="HGNC:9544"
/db_xref="HPRD:04940"
/db_xref="MIM:604030"
/translation="
MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
"
misc_feature 148..756
/gene="PSMB7"
/gene_synonym="Z"
/note="20S proteasome, alpha and beta subunits
[Posttranslational modification, protein turnover,
chaperones]; Region: PRE1; COG0638"
/db_xref="CDD:30983"
mat_peptide 178..879
/gene="PSMB7"
/gene_synonym="Z"
/product="Proteasome subunit beta type-7"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q99436.1)"
misc_feature 178..744
/gene="PSMB7"
/gene_synonym="Z"
/note="proteasome beta type-7 subunit. The 20S proteasome,
multisubunit proteolytic complex, is the central enzyme of
nonlysosomal protein degradation in both the cytosol and
nucleus. It is composed of 28 subunits arranged as four
homoheptameric rings that...; Region:
proteasome_beta_type_7; cd03763"
/db_xref="CDD:48461"
misc_feature order(178..180,226..228,232..234,274..276,562..564,
673..675,682..687)
/gene="PSMB7"
/gene_synonym="Z"
/note="active site"
/db_xref="CDD:48461"
misc_feature order(232..234,241..243,247..264,322..324,328..330,
373..375,409..411,418..423,427..432,439..441,448..450,
517..519,523..525,529..540,547..549,571..576,580..585,
592..600,646..648,667..678,685..690)
/gene="PSMB7"
/gene_synonym="Z"
/note="beta subunit interaction site [polypeptide
binding]; other site"
/db_xref="CDD:48461"
misc_feature 508..510
/gene="PSMB7"
/gene_synonym="Z"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 751..867
/gene="PSMB7"
/gene_synonym="Z"
/note="Proteasome beta subunits C terminal; Region:
Pr_beta_C; pfam12465"
/db_xref="CDD:204931"
exon 111..204
/gene="PSMB7"
/gene_synonym="Z"
/inference="alignment:Splign:1.39.8"
variation 164
/gene="PSMB7"
/gene_synonym="Z"
/replace="c"
/replace="t"
/db_xref="dbSNP:4574"
STS 171..236
/gene="PSMB7"
/gene_synonym="Z"
/standard_name="MARC_8227-8228:996688432:1"
/db_xref="UniSTS:269936"
variation 193
/gene="PSMB7"
/gene_synonym="Z"
/replace="g"
/replace="t"
/db_xref="dbSNP:1803379"
exon 205..302
/gene="PSMB7"
/gene_synonym="Z"
/inference="alignment:Splign:1.39.8"
exon 303..443
/gene="PSMB7"
/gene_synonym="Z"
/inference="alignment:Splign:1.39.8"
exon 444..559
/gene="PSMB7"
/gene_synonym="Z"
/inference="alignment:Splign:1.39.8"
variation 482
/gene="PSMB7"
/gene_synonym="Z"
/replace="a"
/replace="g"
/db_xref="dbSNP:3209221"
exon 560..618
/gene="PSMB7"
/gene_synonym="Z"
/inference="alignment:Splign:1.39.8"
exon 619..770
/gene="PSMB7"
/gene_synonym="Z"
/inference="alignment:Splign:1.39.8"
variation 720
/gene="PSMB7"
/gene_synonym="Z"
/replace="c"
/replace="t"
/db_xref="dbSNP:1803376"
exon 771..1015
/gene="PSMB7"
/gene_synonym="Z"
/inference="alignment:Splign:1.39.8"
variation 796
/gene="PSMB7"
/gene_synonym="Z"
/replace="g"
/replace="t"
/db_xref="dbSNP:1803381"
variation 800
/gene="PSMB7"
/gene_synonym="Z"
/replace="c"
/replace="t"
/db_xref="dbSNP:1803375"
STS 837..958
/gene="PSMB7"
/gene_synonym="Z"
/standard_name="D9S997E"
/db_xref="UniSTS:151244"
STS 853..979
/gene="PSMB7"
/gene_synonym="Z"
/standard_name="WI-15624"
/db_xref="UniSTS:70669"
variation 870
/gene="PSMB7"
/gene_synonym="Z"
/replace="g"
/replace="t"
/db_xref="dbSNP:1803378"
variation 923
/gene="PSMB7"
/gene_synonym="Z"
/replace="g"
/replace="t"
/db_xref="dbSNP:1803377"
polyA_signal 984..989
/gene="PSMB7"
/gene_synonym="Z"
polyA_site 1015
/gene="PSMB7"
/gene_synonym="Z"
ORIGIN
tctttttgtttgcacccgcctccgacccggaactgctttcttgggaagatggcggctgtgtcggtgtatgctccaccagttggaggcttctcttttgataactgccgcaggaatgccgtcttggaagccgattttgcaaagaggggatacaagcttccaaaggtccggaaaactggcacgaccatcgctggggtggtctataaggatggcatagttcttggagcagatacaagagcaactgaagggatggttgttgctgacaagaactgttcaaaaatacacttcatatctcctaatatttattgttgtggtgctgggacagctgcagacacagacatgacaacccagctcatttcttccaacctggagctccactccctctccactggccgtcttcccagagttgtgacagccaatcggatgctgaagcagatgcttttcaggtatcaaggttacattggtgcagccctagttttagggggagtagatgttactggacctcacctctacagcatctatcctcatggatcaactgataagttgccttatgtcaccatgggttctggctccttggcagcaatggctgtatttgaagataagtttaggccagacatggaggaggaggaagccaagaatctggtgagcgaagccatcgcagctggcatcttcaacgacctgggctccggaagcaacattgacctctgcgtcatcagcaagaacaagctggattttctccgcccatacacagtgcccaacaagaaggggaccaggcttggccggtacaggtgtgagaaagggactactgcagtcctcactgagaaaatcactcctctggagattgaggtgctggaagaaacagtccaaacaatggacacttcctgaatggcatcagtgggtggctggccgcggttctggaaggtggtgagcattgaggcccagtaagacactcatgtggctagtgtttgccgaatgaaactcaactcaataaaaaacaaaaaccaaattgggcagctgaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:5695 -> Molecular function: GO:0004298 [threonine-type endopeptidase activity] evidence: IEA
GeneID:5695 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:5695 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS
GeneID:5695 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: TAS
GeneID:5695 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:5695 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS
GeneID:5695 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS
GeneID:5695 -> Biological process: GO:0006521 [regulation of cellular amino acid metabolic process] evidence: TAS
GeneID:5695 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:5695 -> Biological process: GO:0006977 [DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest] evidence: TAS
GeneID:5695 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:5695 -> Biological process: GO:0016032 [viral process] evidence: TAS
GeneID:5695 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS
GeneID:5695 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS
GeneID:5695 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
GeneID:5695 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS
GeneID:5695 -> Biological process: GO:0034641 [cellular nitrogen compound metabolic process] evidence: TAS
GeneID:5695 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS
GeneID:5695 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS
GeneID:5695 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:5695 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
GeneID:5695 -> Biological process: GO:0051436 [negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5695 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5695 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5695 -> Cellular component: GO:0000502 [proteasome complex] evidence: TAS
GeneID:5695 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:5695 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:5695 -> Cellular component: GO:0005839 [proteasome core complex] evidence: ISS
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_002790 -> EC 3.4.25.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.