Home |
Help |
Advanced search
2024-04-19 08:43:16, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002796 925 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens proteasome (prosome, macropain) subunit, beta type, 4
(PSMB4), mRNA.
ACCESSION NM_002796
VERSION NM_002796.2 GI:22538466
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 925)
AUTHORS Lee,K.M., Lee,J. and Park,C.S.
TITLE Cereblon inhibits proteasome activity by binding to the 20S core
proteasome subunit beta type 4
JOURNAL Biochem. Biophys. Res. Commun. 427 (3), 618-622 (2012)
PUBMED 23026050
REMARK GeneRIF: proteasome subunit beta type 4 (PSMB4), the beta7 subunit
of the 20S core complex, was identified as a direct binding partner
of CRBN.
REFERENCE 2 (bases 1 to 925)
AUTHORS Um,J.W., Im,E., Lee,H.J., Min,B., Yoo,L., Yoo,J., Lubbert,H.,
Stichel-Gunkel,C., Cho,H.S., Yoon,J.B. and Chung,K.C.
TITLE Parkin directly modulates 26S proteasome activity
JOURNAL J. Neurosci. 30 (35), 11805-11814 (2010)
PUBMED 20810900
REMARK GeneRIF: While 26 proteasome dysfunction is observed in Parkinson's
disease (PD), diverse mutations in the parkin gene are linked to
early-onset autosomal-recessive forms of familial PD.
REFERENCE 3 (bases 1 to 925)
AUTHORS Yoshida,T., Kato,K., Yokoi,K., Oguri,M., Watanabe,S., Metoki,N.,
Yoshida,H., Satoh,K., Aoyagi,Y., Nozawa,Y. and Yamada,Y.
TITLE Association of genetic variants with hemorrhagic stroke in Japanese
individuals
JOURNAL Int. J. Mol. Med. 25 (4), 649-656 (2010)
PUBMED 20198315
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 4 (bases 1 to 925)
AUTHORS Oguri,M., Kato,K., Yokoi,K., Yoshida,T., Watanabe,S., Metoki,N.,
Yoshida,H., Satoh,K., Aoyagi,Y., Nozawa,Y. and Yamada,Y.
TITLE Assessment of a polymorphism of SDK1 with hypertension in Japanese
Individuals
JOURNAL Am. J. Hypertens. 23 (1), 70-77 (2010)
PUBMED 19851296
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 5 (bases 1 to 925)
AUTHORS Wong,M.L., Dong,C., Maestre-Mesa,J. and Licinio,J.
TITLE Polymorphisms in inflammation-related genes are associated with
susceptibility to major depression and antidepressant response
JOURNAL Mol. Psychiatry 13 (8), 800-812 (2008)
PUBMED 18504423
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 6 (bases 1 to 925)
AUTHORS Kristensen,P., Johnsen,A.H., Uerkvitz,W., Tanaka,K. and Hendil,K.B.
TITLE Human proteasome subunits from 2-dimensional gels identified by
partial sequencing
JOURNAL Biochem. Biophys. Res. Commun. 205 (3), 1785-1789 (1994)
PUBMED 7811265
REMARK Erratum:[Biochem Biophys Res Commun. 1995 Feb 27;207(3):1059. PMID:
7864893]
REFERENCE 7 (bases 1 to 925)
AUTHORS Nothwang,H.G., Tamura,T., Tanaka,K. and Ichihara,A.
TITLE Sequence analyses and inter-species comparisons of three novel
human proteasomal subunits, HsN3, HsC7-I and HsC10-II, confine
potential proteolytic active-site residues
JOURNAL Biochim. Biophys. Acta 1219 (2), 361-368 (1994)
PUBMED 7918633
REFERENCE 8 (bases 1 to 925)
AUTHORS Gerards,W.L., Hop,F.W., Hendriks,I.L. and Bloemendal,H.
TITLE Cloning and expression of a human pro(tea)some beta-subunit cDNA: a
homologue of the yeast PRE4-subunit essential for
peptidylglutamyl-peptide hydrolase activity
JOURNAL FEBS Lett. 346 (2-3), 151-155 (1994)
PUBMED 8013624
REFERENCE 9 (bases 1 to 925)
AUTHORS Rasmussen,H.H., van Damme,J., Puype,M., Gesser,B., Celis,J.E. and
Vandekerckhove,J.
TITLE Microsequences of 145 proteins recorded in the two-dimensional gel
protein database of normal human epidermal keratinocytes
JOURNAL Electrophoresis 13 (12), 960-969 (1992)
PUBMED 1286667
REFERENCE 10 (bases 1 to 925)
AUTHORS Lee,L.W., Moomaw,C.R., Orth,K., McGuire,M.J., DeMartino,G.N. and
Slaughter,C.A.
TITLE Relationships among the subunits of the high molecular weight
proteinase, macropain (proteasome)
JOURNAL Biochim. Biophys. Acta 1037 (2), 178-185 (1990)
PUBMED 2306472
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from D26600.1.
On Aug 29, 2002 this sequence version replaced gi:4506198.
Summary: The proteasome is a multicatalytic proteinase complex with
a highly ordered ring-shaped 20S core structure. The core structure
is composed of 4 rings of 28 non-identical subunits; 2 rings are
composed of 7 alpha subunits and 2 rings are composed of 7 beta
subunits. Proteasomes are distributed throughout eukaryotic cells
at a high concentration and cleave peptides in an
ATP/ubiquitin-dependent process in a non-lysosomal pathway. An
essential function of a modified proteasome, the immunoproteasome,
is the processing of class I MHC peptides. This gene encodes a
member of the proteasome B-type family, also known as the T1B
family, that is a 20S core beta subunit. [provided by RefSeq, Jul
2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: D26600.1, BQ057201.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers
source 1..925
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q21"
gene 1..925
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/note="proteasome (prosome, macropain) subunit, beta type,
4"
/db_xref="GeneID:5692"
/db_xref="HGNC:9541"
/db_xref="HPRD:03710"
/db_xref="MIM:602177"
exon 1..163
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/inference="alignment:Splign:1.39.8"
variation 7
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:2296840"
variation 15
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:200946642"
CDS 24..818
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/EC_number="3.4.25.1"
/note="proteasome subunit HsN3; proteasome beta chain;
macropain beta chain; proteasome chain 3; multicatalytic
endopeptidase complex beta chain; proteasome subunit, beta
type, 4; hsBPROS26; 26 kDa prosomal protein"
/codon_start=1
/product="proteasome subunit beta type-4"
/protein_id="NP_002787.2"
/db_xref="GI:22538467"
/db_xref="CCDS:CCDS996.1"
/db_xref="GeneID:5692"
/db_xref="HGNC:9541"
/db_xref="HPRD:03710"
/db_xref="MIM:602177"
/translation="
MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
"
misc_feature 156..746
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/note="20S proteasome, alpha and beta subunits
[Posttranslational modification, protein turnover,
chaperones]; Region: PRE1; COG0638"
/db_xref="CDD:30983"
misc_feature 177..764
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/note="proteasome beta type-4 subunit. The 20S proteasome,
multisubunit proteolytic complex, is the central enzyme of
nonlysosomal protein degradation in both the cytosol and
nucleus. It is composed of 28 subunits arranged as four
homoheptameric rings that...; Region:
proteasome_beta_type_4; cd03760"
/db_xref="CDD:48458"
misc_feature order(183..185,231..233,237..239,279..281,579..581,
696..698,705..710)
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/note="active site"
/db_xref="CDD:48458"
misc_feature order(237..239,246..248,252..269,327..329,333..335,
378..380,417..419,426..431,435..440,447..449,456..458,
534..536,540..542,546..557,564..566,588..593,597..602,
609..617,669..671,690..701,708..713)
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/note="beta subunit interaction site [polypeptide
binding]; other site"
/db_xref="CDD:48458"
misc_feature 327..329
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphotyrosine; propagated from
UniProtKB/Swiss-Prot (P28070.4); phosphorylation site"
misc_feature 327..329
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
variation 25
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:199968815"
variation 31
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:372329683"
variation 41
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:188568243"
variation 45
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:11557384"
variation 51
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:11557386"
variation 62
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="g"
/replace="t"
/db_xref="dbSNP:149809535"
variation 66
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="g"
/db_xref="dbSNP:111502283"
STS 75..543
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/standard_name="stSG627163"
/db_xref="UniSTS:457256"
variation 91
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:115066321"
variation 98
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:7172"
variation 144
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:375090204"
variation 145
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:113331137"
exon 164..370
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/inference="alignment:Splign:1.39.8"
variation 224
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="g"
/replace="t"
/db_xref="dbSNP:371543427"
variation 233
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="c"
/db_xref="dbSNP:11557388"
variation 246
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="t"
/db_xref="dbSNP:199924460"
variation 271
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:373620750"
STS 285..558
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/standard_name="MARC_13789-13790:1025290513:1"
/db_xref="UniSTS:267555"
variation 296
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:115195104"
variation 308
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="g"
/replace="t"
/db_xref="dbSNP:1804241"
variation 312
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:11557387"
variation 323
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:6684391"
variation 359
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:11557389"
variation 360
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:372581320"
exon 371..517
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/inference="alignment:Splign:1.39.8"
variation 371
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:145190029"
variation 447
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:201438006"
variation 453
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:367717074"
variation 454
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:140771260"
variation 468
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="t"
/db_xref="dbSNP:3209764"
variation 473
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:14276"
variation 482
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:114882311"
variation 489
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="g"
/db_xref="dbSNP:371316814"
variation 511
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="g"
/db_xref="dbSNP:3209765"
exon 518..599
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/inference="alignment:Splign:1.39.8"
variation 565
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:11557382"
variation 566
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:1804239"
variation 580
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:11557385"
variation 589
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="c"
/db_xref="dbSNP:17407993"
variation 593
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="g"
/db_xref="dbSNP:3209715"
exon 600..716
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/inference="alignment:Splign:1.39.8"
variation 609
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:372714296"
variation 648
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:202077271"
variation 650
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:146990256"
variation 675
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:115063024"
variation 677
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="g"
/replace="t"
/db_xref="dbSNP:200407470"
variation 679
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:143739858"
STS 687..800
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/standard_name="G54029"
/db_xref="UniSTS:109411"
STS 687..764
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/standard_name="REN33989"
/db_xref="UniSTS:358789"
variation 695
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:201140984"
variation 702
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:148730084"
STS 714..794
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/standard_name="RH64651"
/db_xref="UniSTS:35030"
exon 717..805
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/inference="alignment:Splign:1.39.8"
variation 724
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:4603"
variation 726
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:144372831"
variation 728
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:116353887"
variation 732
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="g"
/replace="t"
/db_xref="dbSNP:369317780"
variation 738
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="g"
/db_xref="dbSNP:144890599"
variation 744
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="g"
/db_xref="dbSNP:374028323"
variation 790
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:142070497"
exon 806..925
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/inference="alignment:Splign:1.39.8"
variation 823
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:370398473"
variation 841
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="a"
/replace="c"
/db_xref="dbSNP:1804240"
variation 850
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/replace="c"
/replace="t"
/db_xref="dbSNP:373812658"
polyA_signal 908..913
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
polyA_site 925
/gene="PSMB4"
/gene_synonym="HN3; HsN3; PROS-26; PROS26"
/experiment="experimental evidence, no additional details
recorded"
ORIGIN
ttttttctgctaccgtgactaagatggaagcgtttttggggtcgcggtccggactttgggcggggggtccggccccaggacagttttaccgcattccgtccactcccgattccttcatggatccggcgtctgcactttacagaggtccaatcacgcggacccagaaccccatggtgaccgggacctcagtcctcggcgttaagttcgagggcggagtggtgattgccgcagacatgctgggatcctacggctccttggctcgtttccgcaacatctctcgcattatgcgagtcaacaacagtaccatgctgggtgcctctggcgactacgctgatttccagtatttgaagcaagttctcggccagatggtgattgatgaggagcttctgggagatggacacagctatagtcctagagctattcattcatggctgaccagggccatgtacagccggcgctcgaagatgaaccctttgtggaacaccatggtcatcggaggctatgctgatggagagagcttcctcggttatgtggacatgcttggtgtagcctatgaagccccttcgctggccactggttatggtgcatacttggctcagcctctgctgcgagaagttctggagaagcagccagtgctaagccagaccgaggcccgcgacttagtagaacgctgcatgcgagtgctgtactaccgagatgcccgttcttacaaccggtttcaaatcgccactgtcaccgaaaaaggtgttgaaatagagggaccattgtctacagagaccaactgggatattgcccacatgatcagtggctttgaatgaaatacagatgcattatccagaactgaagttgccctacttttaactttgaacttggctagttcaaagatagactcttcttttgtaaagtaaataaattcttcaaaatg
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:5692 -> Molecular function: GO:0001530 [lipopolysaccharide binding] evidence: IEA
GeneID:5692 -> Molecular function: GO:0004298 [threonine-type endopeptidase activity] evidence: IEA
GeneID:5692 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS
GeneID:5692 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: TAS
GeneID:5692 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:5692 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS
GeneID:5692 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS
GeneID:5692 -> Biological process: GO:0002862 [negative regulation of inflammatory response to antigenic stimulus] evidence: IEA
GeneID:5692 -> Biological process: GO:0006521 [regulation of cellular amino acid metabolic process] evidence: TAS
GeneID:5692 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:5692 -> Biological process: GO:0006977 [DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest] evidence: TAS
GeneID:5692 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:5692 -> Biological process: GO:0016032 [viral process] evidence: TAS
GeneID:5692 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS
GeneID:5692 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS
GeneID:5692 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
GeneID:5692 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS
GeneID:5692 -> Biological process: GO:0034641 [cellular nitrogen compound metabolic process] evidence: TAS
GeneID:5692 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS
GeneID:5692 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS
GeneID:5692 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:5692 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
GeneID:5692 -> Biological process: GO:0051436 [negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5692 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5692 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5692 -> Cellular component: GO:0000502 [proteasome complex] evidence: TAS
GeneID:5692 -> Cellular component: GO:0005634 [nucleus] evidence: TAS
GeneID:5692 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:5692 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:5692 -> Cellular component: GO:0005839 [proteasome core complex] evidence: ISS
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_002787 -> EC 3.4.25.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.