Home |
Help |
Advanced search
2024-04-20 15:16:33, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002795 784 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens proteasome (prosome, macropain) subunit, beta type, 3
(PSMB3), mRNA.
ACCESSION NM_002795
VERSION NM_002795.2 GI:22538464
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 784)
AUTHORS Listovsky,T., Oren,Y.S., Yudkovsky,Y., Mahbubani,H.M., Weiss,A.M.,
Lebendiker,M. and Brandeis,M.
TITLE Mammalian Cdh1/Fzr mediates its own degradation
JOURNAL EMBO J. 23 (7), 1619-1626 (2004)
PUBMED 15029244
REFERENCE 2 (bases 1 to 784)
AUTHORS Conticello,S.G., Harris,R.S. and Neuberger,M.S.
TITLE The Vif protein of HIV triggers degradation of the human
antiretroviral DNA deaminase APOBEC3G
JOURNAL Curr. Biol. 13 (22), 2009-2013 (2003)
PUBMED 14614829
REFERENCE 3 (bases 1 to 784)
AUTHORS Yu,X., Yu,Y., Liu,B., Luo,K., Kong,W., Mao,P. and Yu,X.F.
TITLE Induction of APOBEC3G ubiquitination and degradation by an HIV-1
Vif-Cul5-SCF complex
JOURNAL Science 302 (5647), 1056-1060 (2003)
PUBMED 14564014
REFERENCE 4 (bases 1 to 784)
AUTHORS Kao,S., Khan,M.A., Miyagi,E., Plishka,R., Buckler-White,A. and
Strebel,K.
TITLE The human immunodeficiency virus type 1 Vif protein reduces
intracellular expression and inhibits packaging of APOBEC3G
(CEM15), a cellular inhibitor of virus infectivity
JOURNAL J. Virol. 77 (21), 11398-11407 (2003)
PUBMED 14557625
REFERENCE 5 (bases 1 to 784)
AUTHORS Apcher,G.S., Heink,S., Zantopf,D., Kloetzel,P.M., Schmid,H.P.,
Mayer,R.J. and Kruger,E.
TITLE Human immunodeficiency virus-1 Tat protein interacts with distinct
proteasomal alpha and beta subunits
JOURNAL FEBS Lett. 553 (1-2), 200-204 (2003)
PUBMED 14550573
REFERENCE 6 (bases 1 to 784)
AUTHORS Seeger,M., Ferrell,K., Frank,R. and Dubiel,W.
TITLE HIV-1 tat inhibits the 20 S proteasome and its 11 S
regulator-mediated activation
JOURNAL J. Biol. Chem. 272 (13), 8145-8148 (1997)
PUBMED 9079628
REFERENCE 7 (bases 1 to 784)
AUTHORS Coux,O., Tanaka,K. and Goldberg,A.L.
TITLE Structure and functions of the 20S and 26S proteasomes
JOURNAL Annu. Rev. Biochem. 65, 801-847 (1996)
PUBMED 8811196
REMARK Review article
REFERENCE 8 (bases 1 to 784)
AUTHORS Kristensen,P., Johnsen,A.H., Uerkvitz,W., Tanaka,K. and Hendil,K.B.
TITLE Human proteasome subunits from 2-dimensional gels identified by
partial sequencing
JOURNAL Biochem. Biophys. Res. Commun. 205 (3), 1785-1789 (1994)
PUBMED 7811265
REMARK Erratum:[Biochem Biophys Res Commun. 1995 Feb 27;207(3):1059. PMID:
7864893]
REFERENCE 9 (bases 1 to 784)
AUTHORS Nothwang,H.G., Tamura,T., Tanaka,K. and Ichihara,A.
TITLE Sequence analyses and inter-species comparisons of three novel
human proteasomal subunits, HsN3, HsC7-I and HsC10-II, confine
potential proteolytic active-site residues
JOURNAL Biochim. Biophys. Acta 1219 (2), 361-368 (1994)
PUBMED 7918633
REFERENCE 10 (bases 1 to 784)
AUTHORS Rasmussen,H.H., van Damme,J., Puype,M., Gesser,B., Celis,J.E. and
Vandekerckhove,J.
TITLE Microsequences of 145 proteins recorded in the two-dimensional gel
protein database of normal human epidermal keratinocytes
JOURNAL Electrophoresis 13 (12), 960-969 (1992)
PUBMED 1286667
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BC013008.2.
On Aug 29, 2002 this sequence version replaced gi:4506196.
Summary: The proteasome is a multicatalytic proteinase complex with
a highly ordered ring-shaped 20S core structure. The core structure
is composed of 4 rings of 28 non-identical subunits; 2 rings are
composed of 7 alpha subunits and 2 rings are composed of 7 beta
subunits. Proteasomes are distributed throughout eukaryotic cells
at a high concentration and cleave peptides in an
ATP/ubiquitin-dependent process in a non-lysosomal pathway. An
essential function of a modified proteasome, the immunoproteasome,
is the processing of class I MHC peptides. This gene encodes a
member of the proteasome B-type family, also known as the T1B
family, that is a 20S core beta subunit. Pseudogenes have been
identified on chromosomes 2 and 12. [provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BX396725.2, BQ712106.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers
source 1..784
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="17"
/map="17q12"
gene 1..784
/gene="PSMB3"
/gene_synonym="HC10-II"
/note="proteasome (prosome, macropain) subunit, beta type,
3"
/db_xref="GeneID:5691"
/db_xref="HGNC:9540"
/db_xref="HPRD:03709"
/db_xref="MIM:602176"
exon 1..81
/gene="PSMB3"
/gene_synonym="HC10-II"
/inference="alignment:Splign:1.39.8"
variation 14
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:368555754"
variation 27
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="c"
/replace="t"
/db_xref="dbSNP:372825605"
variation 30
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:11654978"
variation 51
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="g"
/replace="t"
/db_xref="dbSNP:370097889"
variation 59
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="g"
/replace="t"
/db_xref="dbSNP:199641079"
variation 60
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:228274"
misc_feature 64..66
/gene="PSMB3"
/gene_synonym="HC10-II"
/note="upstream in-frame stop codon"
CDS 79..696
/gene="PSMB3"
/gene_synonym="HC10-II"
/EC_number="3.4.25.1"
/note="proteasome theta chain; proteasome chain 13;
proteasome component C10-II"
/codon_start=1
/product="proteasome subunit beta type-3"
/protein_id="NP_002786.2"
/db_xref="GI:22538465"
/db_xref="CCDS:CCDS11328.1"
/db_xref="GeneID:5691"
/db_xref="HGNC:9540"
/db_xref="HPRD:03709"
/db_xref="MIM:602176"
/translation="
MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
"
misc_feature 82..84
/gene="PSMB3"
/gene_synonym="HC10-II"
/experiment="experimental evidence, no additional details
recorded"
/note="N-acetylserine; propagated from
UniProtKB/Swiss-Prot (P49720.2); acetylation site"
misc_feature 88..672
/gene="PSMB3"
/gene_synonym="HC10-II"
/note="20S proteasome, alpha and beta subunits
[Posttranslational modification, protein turnover,
chaperones]; Region: PRE1; COG0638"
/db_xref="CDD:30983"
misc_feature 94..681
/gene="PSMB3"
/gene_synonym="HC10-II"
/note="proteasome beta type-3 subunit. The 20S proteasome,
multisubunit proteolytic complex, is the central enzyme of
nonlysosomal protein degradation in both the cytosol and
nucleus. It is composed of 28 subunits arranged as four
homoheptameric rings that...; Region:
proteasome_beta_type_3; cd03759"
/db_xref="CDD:48457"
misc_feature order(103..105,151..153,157..159,199..201,499..501,
610..612,619..624)
/gene="PSMB3"
/gene_synonym="HC10-II"
/note="active site"
/db_xref="CDD:48457"
misc_feature order(157..159,166..168,172..189,247..249,253..255,
298..300,334..336,343..348,352..357,364..366,373..375,
451..453,457..459,463..474,484..486,508..513,517..522,
529..537,583..585,604..615,622..627)
/gene="PSMB3"
/gene_synonym="HC10-II"
/note="beta subunit interaction site [polypeptide
binding]; other site"
/db_xref="CDD:48457"
misc_feature 307..309
/gene="PSMB3"
/gene_synonym="HC10-II"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P49720.2); acetylation site"
exon 82..266
/gene="PSMB3"
/gene_synonym="HC10-II"
/inference="alignment:Splign:1.39.8"
variation 85
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:376644152"
variation 105
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:375168847"
variation 123
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:151259265"
variation 137
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="c"
/replace="t"
/db_xref="dbSNP:370971144"
variation 178
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="t"
/db_xref="dbSNP:4907"
variation 219
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="c"
/replace="t"
/db_xref="dbSNP:376311120"
variation 240
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="c"
/replace="t"
/db_xref="dbSNP:371755222"
exon 267..374
/gene="PSMB3"
/gene_synonym="HC10-II"
/inference="alignment:Splign:1.39.8"
variation 280
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:149971965"
variation 282
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="c"
/replace="g"
/db_xref="dbSNP:371564002"
variation 295
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="c"
/replace="g"
/db_xref="dbSNP:146759507"
variation 319
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="c"
/replace="g"
/db_xref="dbSNP:200701508"
variation 323
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="c"
/replace="t"
/db_xref="dbSNP:114610447"
exon 375..552
/gene="PSMB3"
/gene_synonym="HC10-II"
/inference="alignment:Splign:1.39.8"
variation 415
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="c"
/replace="g"
/db_xref="dbSNP:11553709"
variation 467
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="c"
/db_xref="dbSNP:1804233"
STS 482..717
/gene="PSMB3"
/gene_synonym="HC10-II"
/standard_name="STS-W44512"
/db_xref="UniSTS:5152"
variation 504
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="c"
/replace="t"
/db_xref="dbSNP:145480172"
variation 508
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:201615360"
variation 550
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:371873649"
exon 553..647
/gene="PSMB3"
/gene_synonym="HC10-II"
/inference="alignment:Splign:1.39.8"
variation 558
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:138004688"
variation 592
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="c"
/db_xref="dbSNP:1804235"
STS 647..704
/gene="PSMB3"
/gene_synonym="HC10-II"
/standard_name="D11S4358"
/db_xref="UniSTS:154696"
exon 648..754
/gene="PSMB3"
/gene_synonym="HC10-II"
/inference="alignment:Splign:1.39.8"
variation 654
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:35705506"
variation 662
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="c"
/replace="t"
/db_xref="dbSNP:200486857"
variation 665
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:111684371"
variation 684
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="c"
/replace="t"
/db_xref="dbSNP:143077023"
variation 696
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:3191850"
variation 710
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:192259852"
variation 711
/gene="PSMB3"
/gene_synonym="HC10-II"
/replace="c"
/replace="t"
/db_xref="dbSNP:200971411"
polyA_signal 734..739
/gene="PSMB3"
/gene_synonym="HC10-II"
polyA_site 754
/gene="PSMB3"
/gene_synonym="HC10-II"
/experiment="experimental evidence, no additional details
recorded"
ORIGIN
gagcggttgcgcagtgaaggctagacccggtttactggaattgctctggcgatcgaggggtcctagtacaccgcaatcatgtctattatgtcctataacggaggggccgtcatggccatgaaggggaagaactgtgtggccatcgctgcagacaggcgcttcgggatccaggcccagatggtgaccacggacttccagaagatctttcccatgggtgaccggctgtacatcggtctggccgggctcgccactgacgtccagacagttgcccagcgcctcaagttccggctgaacctgtatgagttgaaggaaggtcggcagatcaaaccttataccctcatgagcatggtggccaacctcttgtatgagaaacggtttggcccttactacactgagccagtcattgccgggttggacccgaagacctttaagcccttcatttgctctctagacctcatcggctgccccatggtgactgatgactttgtggtcagtggcacctgcgccgaacaaatgtacggaatgtgtgagtccctctgggagcccaacatggatccggatcacctgtttgaaaccatctcccaagccatgctgaatgctgtggaccgggatgcagtgtcaggcatgggagtcattgtccacatcatcgagaaggacaaaatcaccaccaggacactgaaggcccgaatggactaaccctgttcccagagcccacttttttttctttttttgaaataaaatagcctgtctttcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:5691 -> Molecular function: GO:0004298 [threonine-type endopeptidase activity] evidence: IEA
GeneID:5691 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS
GeneID:5691 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: TAS
GeneID:5691 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:5691 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS
GeneID:5691 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS
GeneID:5691 -> Biological process: GO:0006521 [regulation of cellular amino acid metabolic process] evidence: TAS
GeneID:5691 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:5691 -> Biological process: GO:0006977 [DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest] evidence: TAS
GeneID:5691 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:5691 -> Biological process: GO:0016032 [viral process] evidence: TAS
GeneID:5691 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS
GeneID:5691 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS
GeneID:5691 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
GeneID:5691 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS
GeneID:5691 -> Biological process: GO:0034641 [cellular nitrogen compound metabolic process] evidence: TAS
GeneID:5691 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS
GeneID:5691 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS
GeneID:5691 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:5691 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
GeneID:5691 -> Biological process: GO:0051436 [negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5691 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5691 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5691 -> Cellular component: GO:0000502 [proteasome complex] evidence: TAS
GeneID:5691 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:5691 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:5691 -> Cellular component: GO:0005839 [proteasome core complex] evidence: ISS
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_002786 -> EC 3.4.25.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.