Home |
Help |
Advanced search
2024-04-26 09:35:23, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002791 1035 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens proteasome (prosome, macropain) subunit, alpha type, 6
(PSMA6), mRNA.
ACCESSION NM_002791
VERSION NM_002791.1 GI:23110943
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1035)
AUTHORS Wang,H., Jiang,M., Zhu,H., Chen,Q., Gong,P., Lin,J., Lu,J. and
Qiu,J.
TITLE Quantitative assessment of the influence of PSMA6 variant
(rs1048990) on coronary artery disease risk
JOURNAL Mol. Biol. Rep. 40 (2), 1035-1041 (2013)
PUBMED 23111455
REMARK GeneRIF: The G allele of PSMA6-8C/G polymorphism is a risk factor
associated with increased coronary artery disease susceptibility.
[Meat-analysis]
REFERENCE 2 (bases 1 to 1035)
AUTHORS Liu,J., Yuan,X.J., Liu,J.X., Tian,L.M., Quan,J.X., Liu,J.,
Chen,X.H., Wang,Y.F., Shi,Z.Y. and Zhang,J.L.
TITLE Validation of the association between PSMA6 -8 C/G polymorphism and
type 2 diabetes mellitus in Chinese Dongxiang and Han populations
JOURNAL Diabetes Res. Clin. Pract. 98 (2), 295-301 (2012)
PUBMED 23026512
REMARK GeneRIF: Investigation suggests that -8 C/G variant of PSMA6 gene
may be associated with T2DM and diabetes-related metabolic traits
in Chinese Dongxiang and Han populations.
REFERENCE 3 (bases 1 to 1035)
AUTHORS Ikeda,S., Tanaka,N., Arai,T., Chida,K., Muramatsu,M. and Sawabe,M.
TITLE Polymorphisms of LTA, LGALS2, and PSMA6 genes and coronary
atherosclerosis: a pathological study of 1503 consecutive autopsy
cases
JOURNAL Atherosclerosis 221 (2), 458-460 (2012)
PUBMED 22310064
REMARK GeneRIF: PSMA6 polymorphisms were not associated with phenotype of
coronary atherosclerosis.
REFERENCE 4 (bases 1 to 1035)
AUTHORS Stuart,P.E., Nair,R.P., Ellinghaus,E., Ding,J., Tejasvi,T.,
Gudjonsson,J.E., Li,Y., Weidinger,S., Eberlein,B., Gieger,C.,
Wichmann,H.E., Kunz,M., Ike,R., Krueger,G.G., Bowcock,A.M.,
Mrowietz,U., Lim,H.W., Voorhees,J.J., Abecasis,G.R.,
Weichenthal,M., Franke,A., Rahman,P., Gladman,D.D. and Elder,J.T.
TITLE Genome-wide association analysis identifies three psoriasis
susceptibility loci
JOURNAL Nat. Genet. 42 (11), 1000-1004 (2010)
PUBMED 20953189
REMARK GeneRIF: Observational study and genome-wide association study of
gene-disease association. (HuGE Navigator)
REFERENCE 5 (bases 1 to 1035)
AUTHORS Bailey SD, Xie C, Do R, Montpetit A, Diaz R, Mohan V, Keavney B,
Yusuf S, Gerstein HC, Engert JC and Anand S.
CONSRTM DREAM investigators
TITLE Variation at the NFATC2 locus increases the risk of
thiazolidinedione-induced edema in the Diabetes REduction
Assessment with ramipril and rosiglitazone Medication (DREAM) study
JOURNAL Diabetes Care 33 (10), 2250-2253 (2010)
PUBMED 20628086
REMARK GeneRIF: Observational study of gene-disease association,
gene-environment interaction, and pharmacogenomic / toxicogenomic.
(HuGE Navigator)
REFERENCE 6 (bases 1 to 1035)
AUTHORS Nederlof,P.M., Wang,H.R. and Baumeister,W.
TITLE Nuclear localization signals of human and Thermoplasma proteasomal
alpha subunits are functional in vitro
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 92 (26), 12060-12064 (1995)
PUBMED 8618844
REFERENCE 7 (bases 1 to 1035)
AUTHORS Kristensen,P., Johnsen,A.H., Uerkvitz,W., Tanaka,K. and Hendil,K.B.
TITLE Human proteasome subunits from 2-dimensional gels identified by
partial sequencing
JOURNAL Biochem. Biophys. Res. Commun. 205 (3), 1785-1789 (1994)
PUBMED 7811265
REMARK Erratum:[Biochem Biophys Res Commun. 1995 Feb 27;207(3):1059. PMID:
7864893]
REFERENCE 8 (bases 1 to 1035)
AUTHORS Kato,S., Sekine,S., Oh,S.W., Kim,N.S., Umezawa,Y., Abe,N.,
Yokoyama-Kobayashi,M. and Aoki,T.
TITLE Construction of a human full-length cDNA bank
JOURNAL Gene 150 (2), 243-250 (1994)
PUBMED 7821789
REFERENCE 9 (bases 1 to 1035)
AUTHORS Bey,F., Silva Pereira,I., Coux,O., Viegas-Pequignot,E., Recillas
Targa,F., Nothwang,H.G., Dutrillaux,B. and Scherrer,K.
TITLE The prosomal RNA-binding protein p27K is a member of the alpha-type
human prosomal gene family
JOURNAL Mol. Gen. Genet. 237 (1-2), 193-205 (1993)
PUBMED 7681138
REFERENCE 10 (bases 1 to 1035)
AUTHORS DeMartino,G.N., Orth,K., McCullough,M.L., Lee,L.W., Munn,T.Z.,
Moomaw,C.R., Dawson,P.A. and Slaughter,C.A.
TITLE The primary structures of four subunits of the human,
high-molecular-weight proteinase, macropain (proteasome), are
distinct but homologous
JOURNAL Biochim. Biophys. Acta 1079 (1), 29-38 (1991)
PUBMED 1888762
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BC017882.1 and BG701535.1.
This sequence is a reference standard in the RefSeqGene project.
Summary: The proteasome is a multicatalytic proteinase complex with
a highly ordered ring-shaped 20S core structure. The core structure
is composed of 4 rings of 28 non-identical subunits; 2 rings are
composed of 7 alpha subunits and 2 rings are composed of 7 beta
subunits. Proteasomes are distributed throughout eukaryotic cells
at a high concentration and cleave peptides in an
ATP/ubiquitin-dependent process in a non-lysosomal pathway. An
essential function of a modified proteasome, the immunoproteasome,
is the processing of class I MHC peptides. This gene encodes a
member of the peptidase T1A family, that is a 20S core alpha
subunit. A pseudogene has been identified on the Y chromosome.
[provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC023659.1, BX355076.2 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers
source 1..1035
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="14"
/map="14q13"
gene 1..1035
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/note="proteasome (prosome, macropain) subunit, alpha
type, 6"
/db_xref="GeneID:5687"
/db_xref="HGNC:9535"
/db_xref="HPRD:04171"
/db_xref="MIM:602855"
exon 1..185
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/inference="alignment:Splign:1.39.8"
variation 19
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="c"
/replace="t"
/db_xref="dbSNP:2277459"
variation 47
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="c"
/replace="t"
/db_xref="dbSNP:150017841"
variation 52
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="g"
/replace="t"
/db_xref="dbSNP:372970614"
variation 60
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="c"
/replace="t"
/db_xref="dbSNP:374244482"
variation 67
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="g"
/replace="t"
/db_xref="dbSNP:11547365"
misc_feature 89..91
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/note="upstream in-frame stop codon"
variation 95
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="c"
/db_xref="dbSNP:371622026"
variation 96
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="g"
/replace="t"
/db_xref="dbSNP:372791678"
variation 102
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="c"
/replace="g"
/db_xref="dbSNP:1048990"
variation 108
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="t"
/db_xref="dbSNP:369824918"
variation 109
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="c"
/replace="t"
/db_xref="dbSNP:374237363"
CDS 110..850
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/EC_number="3.4.25.1"
/note="macropain subunit iota; prosomal P27K protein;
proteasome subunit iota; proteasome iota chain; macropain
iota chain; multicatalytic endopeptidase complex iota
chain; 27 kDa prosomal protein; PROS-27"
/codon_start=1
/product="proteasome subunit alpha type-6"
/protein_id="NP_002782.1"
/db_xref="GI:23110944"
/db_xref="CCDS:CCDS9655.1"
/db_xref="GeneID:5687"
/db_xref="HGNC:9535"
/db_xref="HPRD:04171"
/db_xref="MIM:602855"
/translation="
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD
"
misc_feature 125..826
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/note="proteasome subunit alpha; Provisional; Region:
PRK03996"
/db_xref="CDD:235192"
misc_feature 131..769
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/note="proteasome_alpha_type_6. The 20S proteasome,
multisubunit proteolytic complex, is the central enzyme of
nonlysosomal protein degradation in both the cytosol and
nucleus. It is composed of 28 subunits arranged as four
homoheptameric rings that stack on...; Region:
proteasome_alpha_type_6; cd03754"
/db_xref="CDD:239723"
misc_feature order(140..151,155..160,164..169,179..181,188..190,
197..202,209..211,236..238,281..283,287..292,359..367,
371..376,467..469,476..478,485..490,497..511,563..565,
578..583,587..589,593..598,602..604)
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/note="alpha subunit interaction site [polypeptide
binding]; other site"
/db_xref="CDD:239723"
misc_feature order(218..220,266..268,272..274,311..313,617..619)
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/note="active site"
/db_xref="CDD:239723"
misc_feature 413..415
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P60900.1); acetylation site"
misc_feature 419..421
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P60900.1); acetylation site"
misc_feature 587..589
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
variation 130
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="c"
/replace="g"
/db_xref="dbSNP:11547366"
exon 186..280
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/inference="alignment:Splign:1.39.8"
variation 187
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="g"
/db_xref="dbSNP:140882372"
variation 199
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="g"
/db_xref="dbSNP:56242901"
variation 242
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="c"
/db_xref="dbSNP:149756603"
variation 253
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="g"
/db_xref="dbSNP:370118466"
variation 265
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="g"
/db_xref="dbSNP:201168343"
variation 270..271
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace=""
/replace="a"
/db_xref="dbSNP:35714872"
exon 281..362
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/inference="alignment:Splign:1.39.8"
variation 289
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="g"
/db_xref="dbSNP:374427360"
variation 290
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="c"
/replace="t"
/db_xref="dbSNP:367634774"
variation 294
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="g"
/db_xref="dbSNP:61742040"
variation 352
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="c"
/replace="t"
/db_xref="dbSNP:145545043"
exon 363..518
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/inference="alignment:Splign:1.39.8"
variation 418
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="c"
/replace="t"
/db_xref="dbSNP:138866372"
variation 437
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="c"
/replace="t"
/db_xref="dbSNP:78322008"
variation 478
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="g"
/db_xref="dbSNP:147055056"
exon 519..697
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/inference="alignment:Splign:1.39.8"
variation 551
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="g"
/replace="t"
/db_xref="dbSNP:138406054"
variation 595
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="g"
/db_xref="dbSNP:375160676"
variation 635
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="g"
/db_xref="dbSNP:369403863"
variation 685
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="g"
/db_xref="dbSNP:4665"
exon 698..792
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/inference="alignment:Splign:1.39.8"
variation 709
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="t"
/db_xref="dbSNP:372676999"
variation 722
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="g"
/db_xref="dbSNP:143235746"
variation 774
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="c"
/replace="t"
/db_xref="dbSNP:376971702"
variation 787
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="g"
/db_xref="dbSNP:13393"
exon 793..1018
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/inference="alignment:Splign:1.39.8"
variation 805
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="g"
/db_xref="dbSNP:141553327"
variation 806
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="g"
/replace="t"
/db_xref="dbSNP:55893078"
variation 847
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="c"
/replace="g"
/db_xref="dbSNP:150905180"
STS 864..965
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/standard_name="RH79927"
/db_xref="UniSTS:92770"
variation 876
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="g"
/db_xref="dbSNP:373826164"
variation 879
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="t"
/db_xref="dbSNP:367673861"
variation 903..905
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace=""
/replace="aac"
/db_xref="dbSNP:372087767"
variation 911
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="c"
/db_xref="dbSNP:190785752"
variation 976
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="a"
/replace="g"
/db_xref="dbSNP:111237904"
polyA_signal 992..997
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
variation 1005
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/replace="c"
/replace="g"
/db_xref="dbSNP:182943283"
polyA_site 1015
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/experiment="experimental evidence, no additional details
recorded"
polyA_site 1018
/gene="PSMA6"
/gene_synonym="IOTA; p27K; PROS27"
/experiment="experimental evidence, no additional details
recorded"
ORIGIN
gcggctggtaccccggaagcagtcgctgcaacttccgggaggtgcttgtgtgcctggtgcgggagctacggggcccagggattgtgtttaaagtagtgcttctaccaacatgtcccgtggttccagcgccggttttgaccgccacattaccattttttcacccgagggtcggctctaccaagtagaatatgcttttaaggctattaaccagggtggccttacatcagtagctgtcagagggaaagactgtgcagtaattgtcacacagaagaaagtacctgacaaattattggattccagcacagtgactcacttattcaagataactgaaaacattggttgtgtgatgaccggaatgacagctgacagcagatcccaggtacagagggcacgctatgaggcagctaactggaaatacaagtatggctatgagattcctgtggacatgctgtgtaaaagaattgccgatatttctcaggtctacacacagaatgctgaaatgaggcctcttggttgttgtatgattttaattggtatagatgaagagcaaggccctcaggtatataagtgtgatcctgcaggttactactgtgggtttaaagccactgcagcgggagttaaacaaactgagtcaaccagcttccttgaaaaaaaagtgaagaagaaatttgattggacatttgaacagacagtggaaactgcaattacatgcctgtctactgttctatcaattgatttcaaaccttcagaaatagaagttggagtagtgacagttgaaaatcctaaattcaggattcttacagaagcagagattgatgctcaccttgttgctctagcagagagagactaaacattgtcgttagtttaccagatccgtgatgccacttacctgtgtgtttggtaacaacaaaccaacatcatggaggtccctggattgaaaaaggagcctctcccactcctcctaccaccgaagtggttaggactctatataaataaaaacaaggcttttggaaaataaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:5687 -> Molecular function: GO:0003723 [RNA binding] evidence: IDA
GeneID:5687 -> Molecular function: GO:0003723 [RNA binding] evidence: NAS
GeneID:5687 -> Molecular function: GO:0004175 [endopeptidase activity] evidence: NAS
GeneID:5687 -> Molecular function: GO:0004298 [threonine-type endopeptidase activity] evidence: IEA
GeneID:5687 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:5687 -> Molecular function: GO:0035639 [purine ribonucleoside triphosphate binding] evidence: NAS
GeneID:5687 -> Molecular function: GO:0051059 [NF-kappaB binding] evidence: IPI
GeneID:5687 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS
GeneID:5687 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: TAS
GeneID:5687 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:5687 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS
GeneID:5687 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS
GeneID:5687 -> Biological process: GO:0006511 [ubiquitin-dependent protein catabolic process] evidence: NAS
GeneID:5687 -> Biological process: GO:0006521 [regulation of cellular amino acid metabolic process] evidence: TAS
GeneID:5687 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:5687 -> Biological process: GO:0006977 [DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest] evidence: TAS
GeneID:5687 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:5687 -> Biological process: GO:0016032 [viral process] evidence: TAS
GeneID:5687 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS
GeneID:5687 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS
GeneID:5687 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS
GeneID:5687 -> Biological process: GO:0034641 [cellular nitrogen compound metabolic process] evidence: TAS
GeneID:5687 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS
GeneID:5687 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS
GeneID:5687 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:5687 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
GeneID:5687 -> Biological process: GO:0050727 [regulation of inflammatory response] evidence: IC
GeneID:5687 -> Biological process: GO:0051092 [positive regulation of NF-kappaB transcription factor activity] evidence: IMP
GeneID:5687 -> Biological process: GO:0051436 [negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5687 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5687 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5687 -> Biological process: GO:0051603 [proteolysis involved in cellular protein catabolic process] evidence: IMP
GeneID:5687 -> Cellular component: GO:0000932 [cytoplasmic mRNA processing body] evidence: ISS
GeneID:5687 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:5687 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:5687 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:5687 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA
GeneID:5687 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:5687 -> Cellular component: GO:0005839 [proteasome core complex] evidence: ISS
GeneID:5687 -> Cellular component: GO:0005839 [proteasome core complex] evidence: NAS
GeneID:5687 -> Cellular component: GO:0005844 [polysome] evidence: IDA
GeneID:5687 -> Cellular component: GO:0016363 [nuclear matrix] evidence: ISS
GeneID:5687 -> Cellular component: GO:0019773 [proteasome core complex, alpha-subunit complex] evidence: IDA
GeneID:5687 -> Cellular component: GO:0019773 [proteasome core complex, alpha-subunit complex] evidence: TAS
GeneID:5687 -> Cellular component: GO:0030016 [myofibril] evidence: ISS
GeneID:5687 -> Cellular component: GO:0030017 [sarcomere] evidence: ISS
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_002782 -> EC 3.4.25.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.