Home |
Help |
Advanced search
2024-04-27 09:08:44, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002788 1014 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens proteasome (prosome, macropain) subunit, alpha type, 3
(PSMA3), transcript variant 1, mRNA.
ACCESSION NM_002788
VERSION NM_002788.3 GI:330688466
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1014)
AUTHORS Fedorova,O.A., Moiseeva,T.N., Nikiforov,A.A., Tsimokha,A.S.,
Livinskaya,V.A., Hodson,M., Bottrill,A., Evteeva,I.N.,
Ermolayeva,J.B., Kuznetzova,I.M., Turoverov,K.K., Eperon,I. and
Barlev,N.A.
TITLE Proteomic analysis of the 20S proteasome (PSMA3)-interacting
proteins reveals a functional link between the proteasome and mRNA
metabolism
JOURNAL Biochem. Biophys. Res. Commun. 416 (3-4), 258-265 (2011)
PUBMED 22079093
REMARK GeneRIF: A combination of two-dimensional gel electrophoresis
(2D-GE) and tandem mass-spectrometry revealed a large number of
PSMA3-bound proteins that are involved in various aspects of mRNA
metabolism, including splicing.
REFERENCE 2 (bases 1 to 1014)
AUTHORS Boncela,J., Przygodzka,P., Papiewska-Pajak,I., Wyroba,E.,
Osinska,M. and Cierniewski,C.S.
TITLE Plasminogen activator inhibitor type 1 interacts with alpha3
subunit of proteasome and modulates its activity
JOURNAL J. Biol. Chem. 286 (8), 6820-6831 (2011)
PUBMED 21135093
REMARK GeneRIF: Plasminogen activator inhibitor type 1 interacts with
alpha3 subunit of proteasome and modulates its activity.
REFERENCE 3 (bases 1 to 1014)
AUTHORS Yousef,A.A., Suliman,G.A. and Mabrouk,M.M.
TITLE The value of correlation of serum 20S proteasome concentration and
percentage of lymphocytic apoptosis in critically ill patients: a
prospective observational study
JOURNAL Crit Care 14 (6), R215 (2010)
PUBMED 21108816
REMARK GeneRIF: Serum 20S proteasome concentration and percentage of
lymphocytic apoptosis predicted survival and patient prognosis in
critically ill patients.
REFERENCE 4 (bases 1 to 1014)
AUTHORS Parfitt,D.A., Michael,G.J., Vermeulen,E.G., Prodromou,N.V.,
Webb,T.R., Gallo,J.M., Cheetham,M.E., Nicoll,W.S., Blatch,G.L. and
Chapple,J.P.
TITLE The ataxia protein sacsin is a functional co-chaperone that
protects against polyglutamine-expanded ataxin-1
JOURNAL Hum. Mol. Genet. 18 (9), 1556-1565 (2009)
PUBMED 19208651
REFERENCE 5 (bases 1 to 1014)
AUTHORS Yuksek,K., Chen,W.L., Chien,D. and Ou,J.H.
TITLE Ubiquitin-independent degradation of hepatitis C virus F protein
JOURNAL J. Virol. 83 (2), 612-621 (2009)
PUBMED 18971267
REMARK GeneRIF: The authors propose that the full-length HCV F protein as
well as the F protein initiating from codon 26 is degraded by an
ubiquitin-independent pathway that is mediated by the proteasome
subunit alpha3.
REFERENCE 6 (bases 1 to 1014)
AUTHORS Castano,J.G., Mahillo,E., Arizti,P. and Arribas,J.
TITLE Phosphorylation of C8 and C9 subunits of the multicatalytic
proteinase by casein kinase II and identification of the C8
phosphorylation sites by direct mutagenesis
JOURNAL Biochemistry 35 (12), 3782-3789 (1996)
PUBMED 8619999
REFERENCE 7 (bases 1 to 1014)
AUTHORS Coux,O., Tanaka,K. and Goldberg,A.L.
TITLE Structure and functions of the 20S and 26S proteasomes
JOURNAL Annu. Rev. Biochem. 65, 801-847 (1996)
PUBMED 8811196
REMARK Review article
REFERENCE 8 (bases 1 to 1014)
AUTHORS Akioka,H., Forsberg,N.E., Ishida,N., Okumura,K., Nogami,M.,
Taguchi,H., Noda,C. and Tanaka,K.
TITLE Isolation and characterization of the HC8 subunit gene of the human
proteasome
JOURNAL Biochem. Biophys. Res. Commun. 207 (1), 318-323 (1995)
PUBMED 7857283
REFERENCE 9 (bases 1 to 1014)
AUTHORS Kristensen,P., Johnsen,A.H., Uerkvitz,W., Tanaka,K. and Hendil,K.B.
TITLE Human proteasome subunits from 2-dimensional gels identified by
partial sequencing
JOURNAL Biochem. Biophys. Res. Commun. 205 (3), 1785-1789 (1994)
PUBMED 7811265
REMARK Erratum:[Biochem Biophys Res Commun. 1995 Feb 27;207(3):1059. PMID:
7864893]
REFERENCE 10 (bases 1 to 1014)
AUTHORS Tamura,T., Lee,D.H., Osaka,F., Fujiwara,T., Shin,S., Chung,C.H.,
Tanaka,K. and Ichihara,A.
TITLE Molecular cloning and sequence analysis of cDNAs for five major
subunits of human proteasomes (multi-catalytic proteinase
complexes)
JOURNAL Biochim. Biophys. Acta 1089 (1), 95-102 (1991)
PUBMED 2025653
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from CF128376.1, D00762.1 and
BC038990.1.
On Apr 27, 2011 this sequence version replaced gi:23110937.
Summary: The proteasome is a multicatalytic proteinase complex with
a highly ordered ring-shaped 20S core structure. The core structure
is composed of 4 rings of 28 non-identical subunits; 2 rings are
composed of 7 alpha subunits and 2 rings are composed of 7 beta
subunits. Proteasomes are distributed throughout eukaryotic cells
at a high concentration and cleave peptides in an
ATP/ubiquitin-dependent process in a non-lysosomal pathway. An
essential function of a modified proteasome, the immunoproteasome,
is the processing of class I MHC peptides. This gene encodes a
member of the peptidase T1A family, that is a 20S core alpha
subunit. Two alternative transcripts encoding different isoforms
have been identified. [provided by RefSeq, Jul 2008].
Transcript Variant: This variant (1) encodes the longer isoform.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC038990.1, BQ955290.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-111 CF128376.1 1-111
112-949 D00762.1 1-838
950-1014 BC038990.1 877-941
FEATURES Location/Qualifiers
source 1..1014
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="14"
/map="14q23"
gene 1..1014
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/note="proteasome (prosome, macropain) subunit, alpha
type, 3"
/db_xref="GeneID:5684"
/db_xref="HGNC:9532"
/db_xref="HPRD:01463"
/db_xref="MIM:176843"
exon 1..137
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/inference="alignment:Splign:1.39.8"
misc_feature 63..65
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/note="upstream in-frame stop codon"
variation 72
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="c"
/db_xref="dbSNP:200319799"
variation 76
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="c"
/db_xref="dbSNP:375729415"
variation 79
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:200837709"
variation 80
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:201941830"
variation 83
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:371805393"
variation 89
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:187984170"
CDS 117..884
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/EC_number="3.4.25.1"
/note="isoform 1 is encoded by transcript variant 1;
proteasome subunit C8; macropain subunit C8;
multicatalytic endopeptidase complex subunit C8;
proteasome subunit alpha type-3; proteasome component C8"
/codon_start=1
/product="proteasome subunit alpha type-3 isoform 1"
/protein_id="NP_002779.1"
/db_xref="GI:4506183"
/db_xref="CCDS:CCDS9731.1"
/db_xref="GeneID:5684"
/db_xref="HGNC:9532"
/db_xref="HPRD:01463"
/db_xref="MIM:176843"
/translation="
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM
"
misc_feature 120..122
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/experiment="experimental evidence, no additional details
recorded"
/note="N-acetylserine; propagated from
UniProtKB/Swiss-Prot (P25788.2); acetylation site"
misc_feature 120..122
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/experiment="experimental evidence, no additional details
recorded"
/note="acetylation site"
misc_feature 129..767
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/note="proteasome_alpha_type_3. The 20S proteasome,
multisubunit proteolytic complex, is the central enzyme of
nonlysosomal protein degradation in both the cytosol and
nucleus. It is composed of 28 subunits arranged as four
homoheptameric rings that stack on...; Region:
proteasome_alpha_type_3; cd03751"
/db_xref="CDD:48449"
misc_feature 132..833
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/note="proteasome subunit alpha; Provisional; Region:
PRK03996"
/db_xref="CDD:179701"
misc_feature order(144..155,159..164,168..173,183..185,192..194,
201..206,213..215,237..239,282..284,288..293,360..368,
372..377,468..470,477..479,486..491,498..512,564..566,
579..584,588..590,594..599,603..605)
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/note="alpha subunit interaction site [polypeptide
binding]; other site"
/db_xref="CDD:48449"
misc_feature order(219..221,267..269,273..275,312..314,618..620)
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/note="active site"
/db_xref="CDD:48449"
misc_feature 285..287
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P25788.2); acetylation site"
misc_feature 597..599
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 732..734
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P25788.2); acetylation site"
misc_feature 804..806
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P25788.2); acetylation site"
misc_feature 843..845
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P25788.2); phosphorylation site"
misc_feature 843..845
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[6]
misc_feature 843..845
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[6]
/db_xref="HPRD:00277"
misc_feature 864..866
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P25788.2); phosphorylation site"
misc_feature 864..866
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 864..866
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
variation 131
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:368712816"
exon 138..220
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/inference="alignment:Splign:1.39.8"
variation 191
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:199770893"
variation 197
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:201912576"
variation 215
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:373005377"
exon 221..344
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/inference="alignment:Splign:1.39.8"
variation 254
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:11556302"
variation 260
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:181507532"
variation 263
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:144084081"
variation 314
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:145114489"
variation 315
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="g"
/db_xref="dbSNP:370015963"
exon 345..446
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/inference="alignment:Splign:1.39.8"
variation 383
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:17852655"
variation 389
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:17852656"
variation 390
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:374139645"
variation 392
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:11556303"
variation 397
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:199944562"
variation 431
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:11556304"
variation 434
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:377189095"
exon 447..520
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/inference="alignment:Splign:1.39.8"
exon 521..593
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/inference="alignment:Splign:1.39.8"
variation 557
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:374534971"
variation 593
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:112146406"
exon 594..659
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/inference="alignment:Splign:1.39.8"
variation 599
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:149394834"
variation 610
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:144791534"
variation 614
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:189216032"
variation 626
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:17852654"
exon 660..706
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/inference="alignment:Splign:1.39.8"
variation 666
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="g"
/db_xref="dbSNP:377728633"
variation 697
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:148626478"
variation 706
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:142139987"
exon 707..774
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/inference="alignment:Splign:1.39.8"
variation 714
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:200984115"
variation 725
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:146180750"
variation 729
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:373695669"
variation 731
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:376700376"
variation 743
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="t"
/db_xref="dbSNP:3208867"
exon 775..839
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/inference="alignment:Splign:1.39.8"
variation 783
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:368886678"
variation 806
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:201086253"
variation 820
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="c"
/db_xref="dbSNP:139132472"
STS 829..966
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/standard_name="RH17928"
/db_xref="UniSTS:51626"
variation 834
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="g"
/db_xref="dbSNP:3208868"
variation 835
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="c"
/replace="t"
/db_xref="dbSNP:3208869"
exon 840..998
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/inference="alignment:Splign:1.39.8"
variation 842
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:376830435"
STS 845..969
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/standard_name="SHGC-32634"
/db_xref="UniSTS:21204"
STS 850..969
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/standard_name="SHGC-34645"
/db_xref="UniSTS:21203"
variation 857
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="t"
/db_xref="dbSNP:144136958"
variation 902
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace="a"
/replace="g"
/db_xref="dbSNP:369029493"
variation 954..955
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace=""
/replace="t"
/db_xref="dbSNP:3830963"
variation 968..969
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
/replace=""
/replace="t"
/db_xref="dbSNP:34841681"
polyA_signal 974..979
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
polyA_site 998
/gene="PSMA3"
/gene_synonym="HC8; PSC3"
ORIGIN
gttattggttggcagttcagccaatgagcgggcctgttactagtttgcggcatcctgtggtataggggaagcgctccgggcctggaatccctacgcgtccctttgggtttagcacgatgagctcaatcggcactgggtatgacctgtcagcctctacattctctcctgacggaagagtttttcaagttgaatatgctatgaaggctgtggaaaatagtagtacagctattggaatcagatgcaaagatggtgttgtctttggggtagaaaaattagtcctttctaaactttatgaagaaggttccaacaaaagactttttaatgttgatcggcatgttggaatggcagtagcaggtttgttggcagatgctcgttctttagcagacatagcaagagaagaagcttccaacttcagatctaactttggctacaacattccactaaaacatcttgcagacagagtggccatgtatgtgcatgcatatacactctacagtgctgttagaccttttggctgcagtttcatgttagggtcttacagtgtgaatgacggtgcgcaactctacatgattgacccatcaggtgtttcatacggttattggggctgtgccatcggcaaagccaggcaagctgcaaagacggaaatagagaagcttcagatgaaagaaatgacctgccgtgatatcgttaaagaagttgcaaaaataatttacatagtacatgacgaagttaaggataaagcttttgaactagaactcagctgggttggtgaattaactaatggaagacatgaaattgttccaaaagatataagagaagaagcagagaaatatgctaaggaatctctgaaggaagaagatgaatcagatgatgataatatgtaacatttactccagcatctattgtattttaaatttctactccagtccaatgtaactatttagccctggattatacatactgtccaattttcattaaatttttgtcttataactattaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:5684 -> Molecular function: GO:0004298 [threonine-type endopeptidase activity] evidence: IEA
GeneID:5684 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:5684 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS
GeneID:5684 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: TAS
GeneID:5684 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:5684 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS
GeneID:5684 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS
GeneID:5684 -> Biological process: GO:0006521 [regulation of cellular amino acid metabolic process] evidence: TAS
GeneID:5684 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:5684 -> Biological process: GO:0006977 [DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest] evidence: TAS
GeneID:5684 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:5684 -> Biological process: GO:0016032 [viral process] evidence: TAS
GeneID:5684 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS
GeneID:5684 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS
GeneID:5684 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
GeneID:5684 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS
GeneID:5684 -> Biological process: GO:0034641 [cellular nitrogen compound metabolic process] evidence: TAS
GeneID:5684 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS
GeneID:5684 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS
GeneID:5684 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:5684 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
GeneID:5684 -> Biological process: GO:0051436 [negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5684 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5684 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5684 -> Cellular component: GO:0000502 [proteasome complex] evidence: TAS
GeneID:5684 -> Cellular component: GO:0005634 [nucleus] evidence: TAS
GeneID:5684 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:5684 -> Cellular component: GO:0005737 [cytoplasm] evidence: TAS
GeneID:5684 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:5684 -> Cellular component: GO:0005839 [proteasome core complex] evidence: IDA
GeneID:5684 -> Cellular component: GO:0019773 [proteasome core complex, alpha-subunit complex] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_002779 -> EC 3.4.25.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.