Home |
Help |
Advanced search
2024-04-25 20:30:41, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002786 1281 bp mRNA linear PRI 29-JUN-2013
DEFINITION Homo sapiens proteasome (prosome, macropain) subunit, alpha type, 1
(PSMA1), transcript variant 2, mRNA.
ACCESSION NM_002786
VERSION NM_002786.3 GI:221316713
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1281)
AUTHORS Sherva,R., Tripodis,Y., Bennett,D.A., Chibnik,L.B., Crane,P.K., de
Jager,P.L., Farrer,L.A., Saykin,A.J., Shulman,J.M. and Green,R.C.
CONSRTM The GENAROADS Consortium, and The Alzheimer's Disease Neuroimaging
Initiative
TITLE Genome-wide association study of the rate of cognitive decline in
Alzheimer's disease
JOURNAL Alzheimers Dement (2013) In press
PUBMED 23535033
REMARK Publication Status: Available-Online prior to print
REFERENCE 2 (bases 1 to 1281)
AUTHORS Yokota,N., Kataoka,Y., Hashii,N., Kawasaki,N. and Sawada,H.
TITLE Sperm-specific C-terminal processing of the proteasome PSMA1/alpha6
subunit
JOURNAL Biochem. Biophys. Res. Commun. 410 (4), 809-815 (2011)
PUBMED 21703233
REMARK GeneRIF: LC/MS/MS analysis revealed that the C-terminal 16 residues
of sperm alpha6 subunit are processed.
REFERENCE 3 (bases 1 to 1281)
AUTHORS Zhang,Y., Jia,L., Lee,S.J. and Wang,M.M.
TITLE Conserved signal peptide of Notch3 inhibits interaction with
proteasome
JOURNAL Biochem. Biophys. Res. Commun. 355 (1), 245-251 (2007)
PUBMED 17292860
REMARK Erratum:[Biochem Biophys Res Commun. 2007 Aug 3;359(3):840]
REFERENCE 4 (bases 1 to 1281)
AUTHORS Apcher,G.S., Maitland,J., Dawson,S., Sheppard,P. and Mayer,R.J.
TITLE The alpha4 and alpha7 subunits and assembly of the 20S proteasome
JOURNAL FEBS Lett. 569 (1-3), 211-216 (2004)
PUBMED 15225636
REFERENCE 5 (bases 1 to 1281)
AUTHORS Jayarapu,K. and Griffin,T.A.
TITLE Protein-protein interactions among human 20S proteasome subunits
and proteassemblin
JOURNAL Biochem. Biophys. Res. Commun. 314 (2), 523-528 (2004)
PUBMED 14733938
REFERENCE 6 (bases 1 to 1281)
AUTHORS Silva Pereira,I., Bey,F., Coux,O. and Scherrer,K.
TITLE Two mRNAs exist for the Hs PROS-30 gene encoding a component of
human prosomes
JOURNAL Gene 120 (2), 235-242 (1992)
PUBMED 1398136
REFERENCE 7 (bases 1 to 1281)
AUTHORS Shimbara,N., Orino,E., Sone,S., Ogura,T., Takashina,M., Shono,M.,
Tamura,T., Yasuda,H., Tanaka,K. and Ichihara,A.
TITLE Regulation of gene expression of proteasomes (multi-protease
complexes) during growth and differentiation of human hematopoietic
cells
JOURNAL J. Biol. Chem. 267 (25), 18100-18109 (1992)
PUBMED 1517242
REFERENCE 8 (bases 1 to 1281)
AUTHORS Kanayama,H., Tanaka,K., Aki,M., Kagawa,S., Miyaji,H., Satoh,M.,
Okada,F., Sato,S., Shimbara,N. and Ichihara,A.
TITLE Changes in expressions of proteasome and ubiquitin genes in human
renal cancer cells
JOURNAL Cancer Res. 51 (24), 6677-6685 (1991)
PUBMED 1660345
REFERENCE 9 (bases 1 to 1281)
AUTHORS DeMartino,G.N., Orth,K., McCullough,M.L., Lee,L.W., Munn,T.Z.,
Moomaw,C.R., Dawson,P.A. and Slaughter,C.A.
TITLE The primary structures of four subunits of the human,
high-molecular-weight proteinase, macropain (proteasome), are
distinct but homologous
JOURNAL Biochim. Biophys. Acta 1079 (1), 29-38 (1991)
PUBMED 1888762
REFERENCE 10 (bases 1 to 1281)
AUTHORS Tamura,T., Lee,D.H., Osaka,F., Fujiwara,T., Shin,S., Chung,C.H.,
Tanaka,K. and Ichihara,A.
TITLE Molecular cloning and sequence analysis of cDNAs for five major
subunits of human proteasomes (multi-catalytic proteinase
complexes)
JOURNAL Biochim. Biophys. Acta 1089 (1), 95-102 (1991)
PUBMED 2025653
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DA549688.1 and BC002577.2.
On Jan 24, 2009 this sequence version replaced gi:23110933.
Summary: The proteasome is a multicatalytic proteinase complex with
a highly ordered ring-shaped 20S core structure. The core structure
is composed of 4 rings of 28 non-identical subunits; 2 rings are
composed of 7 alpha subunits and 2 rings are composed of 7 beta
subunits. Proteasomes are distributed throughout eukaryotic cells
at a high concentration and cleave peptides in an
ATP/ubiquitin-dependent process in a non-lysosomal pathway. An
essential function of a modified proteasome, the immunoproteasome,
is the processing of class I MHC peptides. This gene encodes a
member of the peptidase T1A family, that is a 20S core alpha
subunit. Alternative splicing results in multiple transcript
variants encoding distinct isoforms.[provided by RefSeq, Jan 2009].
Transcript Variant: This variant (2) differs in the 5' UTR and 5'
coding region, compared to variant 1. The encoded isoform (2), also
known as the short isoform, has a shorter N-terminus compared to
isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: X61969.1, BC005932.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025081, ERS025082 [ECO:0000350]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-81 DA549688.1 1-81
82-1281 BC002577.2 1-1200
FEATURES Location/Qualifiers
source 1..1281
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="11"
/map="11p15.1"
gene 1..1281
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/note="proteasome (prosome, macropain) subunit, alpha
type, 1"
/db_xref="GeneID:5682"
/db_xref="HGNC:9530"
/db_xref="MIM:602854"
exon 1..149
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/inference="alignment:Splign:1.39.8"
CDS 147..938
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/EC_number="3.4.25.1"
/note="isoform 2 is encoded by transcript variant 2;
proteasome subunit nu; macropain subunit nu; protein
P30-33K; proteasome component C2; multicatalytic
endopeptidase complex subunit C2; proteasome nu chain; 30
kDa prosomal protein; proteasome subunit, alpha-type, 1;
proteasome subunit alpha type-1; PROS-30; macropain
subunit C2"
/codon_start=1
/product="proteasome subunit alpha type-1 isoform 2"
/protein_id="NP_002777.1"
/db_xref="GI:4506179"
/db_xref="CCDS:CCDS7816.1"
/db_xref="GeneID:5682"
/db_xref="HGNC:9530"
/db_xref="MIM:602854"
/translation="
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH
"
misc_feature 156..863
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/note="20S proteasome, alpha and beta subunits
[Posttranslational modification, protein turnover,
chaperones]; Region: PRE1; COG0638"
/db_xref="CDD:223711"
misc_feature 162..794
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/note="proteasome_alpha_type_1. The 20S proteasome,
multisubunit proteolytic complex, is the central enzyme of
nonlysosomal protein degradation in both the cytosol and
nucleus. It is composed of 28 subunits arranged as four
homoheptameric rings that stack on...; Region:
proteasome_alpha_type_1; cd03749"
/db_xref="CDD:239718"
misc_feature order(168..179,183..188,192..197,207..209,216..218,
225..230,237..239,261..263,306..308,312..317,378..386,
390..395,486..488,495..497,504..509,516..530,579..581,
594..599,603..605,609..614,618..620)
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/note="alpha subunit interaction site [polypeptide
binding]; other site"
/db_xref="CDD:239718"
misc_feature 186..188
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P25786.1); phosphorylation site"
misc_feature order(243..245,291..293,297..299,330..332,633..635)
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/note="active site"
/db_xref="CDD:239718"
exon 150..194
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/inference="alignment:Splign:1.39.8"
exon 195..296
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/inference="alignment:Splign:1.39.8"
exon 297..400
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/inference="alignment:Splign:1.39.8"
exon 401..489
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/inference="alignment:Splign:1.39.8"
exon 490..560
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/inference="alignment:Splign:1.39.8"
exon 561..690
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/inference="alignment:Splign:1.39.8"
exon 691..770
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/inference="alignment:Splign:1.39.8"
exon 771..881
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/inference="alignment:Splign:1.39.8"
STS 822..953
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/standard_name="RH38736"
/db_xref="UniSTS:88705"
exon 882..1254
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/inference="alignment:Splign:1.39.8"
STS 884..1049
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/standard_name="PSMA1"
/db_xref="UniSTS:72272"
STS 967..1251
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/standard_name="D11S4431"
/db_xref="UniSTS:22423"
STS 967..1070
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/standard_name="G19402"
/db_xref="UniSTS:68469"
variation 988
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/replace="a"
/replace="c"
/db_xref="dbSNP:1051046"
STS 1082..1230
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
/standard_name="D11S4651"
/db_xref="UniSTS:77758"
polyA_signal 1229..1235
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
polyA_site 1254
/gene="PSMA1"
/gene_synonym="HC2; NU; PROS30"
ORIGIN
gatatctctggaatagactgcgctaccctgcgccgccgccgtcaaactcccgcagacttctctgtagatcgctgagcgatactttcggcagcacctccttgattctcagttttgctggaggccgcaaccaggcccgcgccgccaccatgtttcgaaatcagtatgacaatgatgtcactgtttggagcccccagggcaggattcatcaaattgaatatgcaatggaagctgttaaacaaggttcagccacagttggtctgaaatcaaaaactcatgcagttttggttgcattgaaaagggcgcaatcagagcttgcagctcatcagaaaaaaattctccatgttgacaaccatattggtatctcaattgcggggcttactgctgatgctagactgttatgtaattttatgcgtcaggagtgtttggattccagatttgtattcgatagaccactgcctgtgtctcgtcttgtatctctaattggaagcaagacccagataccaacacaacgatatggccggagaccatatggtgttggtctccttattgctggttatgatgatatgggccctcacattttccaaacctgtccatctgctaactattttgactgcagagccatgtccattggagcccgttcccaatcagctcgtacttacttggagagacatatgtctgaatttatggagtgtaatttaaatgaactagttaaacatggtctgcgtgccttaagagagacgcttcctgcagaacaggacctgactacaaagaatgtttccattggaattgttggtaaagacttggagtttacaatctatgatgatgatgatgtgtctccattcctggaaggtcttgaagaaagaccacagagaaaggcacagcctgctcaacctgctgatgaacctgcagaaaaggctgatgaaccaatggaacattaagtgataagccagtctatatatgtattatcaaatatgtaagaatacaggcaccacatactgatgacaataatctatactttgaaccaaaagttgcagagtggtggaatgctatgttttaggaatcagtccagatgtgagttttttccaagcaacctcactgaaacctatataatggaatacatttttctttgaaagggtctgtataatcattttctagaaagtatgggtatctatactaatgtttttatatgaagaacataggtgtctttgtggttttaaagacaactgtgaaataaaattgtttcaccgcctggtaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:5682 -> Molecular function: GO:0003723 [RNA binding] evidence: TAS
GeneID:5682 -> Molecular function: GO:0004298 [threonine-type endopeptidase activity] evidence: IEA
GeneID:5682 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:5682 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS
GeneID:5682 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: TAS
GeneID:5682 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:5682 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS
GeneID:5682 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS
GeneID:5682 -> Biological process: GO:0006521 [regulation of cellular amino acid metabolic process] evidence: TAS
GeneID:5682 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:5682 -> Biological process: GO:0006977 [DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest] evidence: TAS
GeneID:5682 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:5682 -> Biological process: GO:0016032 [viral process] evidence: TAS
GeneID:5682 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS
GeneID:5682 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS
GeneID:5682 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS
GeneID:5682 -> Biological process: GO:0034641 [cellular nitrogen compound metabolic process] evidence: TAS
GeneID:5682 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS
GeneID:5682 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS
GeneID:5682 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:5682 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
GeneID:5682 -> Biological process: GO:0051436 [negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5682 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5682 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:5682 -> Cellular component: GO:0000502 [proteasome complex] evidence: TAS
GeneID:5682 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:5682 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:5682 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
GeneID:5682 -> Cellular component: GO:0005813 [centrosome] evidence: IDA
GeneID:5682 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:5682 -> Cellular component: GO:0005839 [proteasome core complex] evidence: ISS
GeneID:5682 -> Cellular component: GO:0005844 [polysome] evidence: TAS
GeneID:5682 -> Cellular component: GO:0019773 [proteasome core complex, alpha-subunit complex] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_002777 -> EC 3.4.25.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.