2024-03-29 03:00:28, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002758 1879 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens mitogen-activated protein kinase kinase 6 (MAP2K6), mRNA. ACCESSION NM_002758 VERSION NM_002758.3 GI:90577186 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1879) AUTHORS Krintel,S.B., Palermo,G., Johansen,J.S., Germer,S., Essioux,L., Benayed,R., Badi,L., Ostergaard,M. and Hetland,M.L. TITLE Investigation of single nucleotide polymorphisms and biological pathways associated with response to TNFalpha inhibitors in patients with rheumatoid arthritis JOURNAL Pharmacogenet. Genomics 22 (8), 577-589 (2012) PUBMED 22569225 REFERENCE 2 (bases 1 to 1879) AUTHORS Otto,K.B., Acharya,S.S. and Robinson,V.L. TITLE Stress-activated kinase pathway alteration is a frequent event in bladder cancer JOURNAL Urol. Oncol. 30 (4), 415-420 (2012) PUBMED 22154358 REMARK GeneRIF: Data suggest aberrant MAP2K protein (MKK3, MKK4, MKK6, and MKK7) expression indicates that altered cellular signal transduction mediated via JNK and p38 may be common in bladder cancer. REFERENCE 3 (bases 1 to 1879) AUTHORS Matsumoto,T., Kinoshita,T., Matsuzaka,H., Nakai,R., Kirii,Y., Yokota,K. and Tada,T. TITLE Crystal structure of non-phosphorylated MAP2K6 in a putative auto-inhibition state JOURNAL J. Biochem. 151 (5), 541-549 (2012) PUBMED 22383536 REMARK GeneRIF: crystal structure of human non-phosphorylated MAP2K6 (npMAP2K6) complexed with an ATP analogue was determined at 2.6 A resolution and represents an auto-inhibition state of MAP2K6 REFERENCE 4 (bases 1 to 1879) AUTHORS Ding,N., Wang,F., Han,Y., Xiao,H., Xu,L. and She,S. TITLE Mitogen-activated protein kinase kinase 6 mediates mechanical stretch-induced high-mobility group box 1 protein expression in pulmonary alveolar epithelial cells JOURNAL J Trauma Acute Care Surg 72 (1), 162-168 (2012) PUBMED 21926646 REMARK GeneRIF: activation by mechanical stretch induces HMGB1 and cytokine expression in A549 cells REFERENCE 5 (bases 1 to 1879) AUTHORS Galan-Moya,E.M., de la Cruz-Morcillo,M.A., Llanos Valero,M., Callejas-Valera,J.L., Melgar-Rojas,P., Hernadez Losa,J., Salcedo,M., Fernandez-Aramburo,A., Ramon y Cajal,S. and Sanchez-Prieto,R. TITLE Balance between MKK6 and MKK3 mediates p38 MAPK associated resistance to cisplatin in NSCLC JOURNAL PLoS ONE 6 (12), E28406 (2011) PUBMED 22164285 REMARK GeneRIF: the balance between MKK6 and MKK3 mediates p38 MAPK associated resistance to cisplatin in NSCLC REFERENCE 6 (bases 1 to 1879) AUTHORS Moriguchi,T., Kuroyanagi,N., Yamaguchi,K., Gotoh,Y., Irie,K., Kano,T., Shirakabe,K., Muro,Y., Shibuya,H., Matsumoto,K., Nishida,E. and Hagiwara,M. TITLE A novel kinase cascade mediated by mitogen-activated protein kinase kinase 6 and MKK3 JOURNAL J. Biol. Chem. 271 (23), 13675-13679 (1996) PUBMED 8663074 REFERENCE 7 (bases 1 to 1879) AUTHORS Stein,B., Brady,H., Yang,M.X., Young,D.B. and Barbosa,M.S. TITLE Cloning and characterization of MEK6, a novel member of the mitogen-activated protein kinase kinase cascade JOURNAL J. Biol. Chem. 271 (19), 11427-11433 (1996) PUBMED 8626699 REFERENCE 8 (bases 1 to 1879) AUTHORS Raingeaud,J., Whitmarsh,A.J., Barrett,T., Derijard,B. and Davis,R.J. TITLE MKK3- and MKK6-regulated gene expression is mediated by the p38 mitogen-activated protein kinase signal transduction pathway JOURNAL Mol. Cell. Biol. 16 (3), 1247-1255 (1996) PUBMED 8622669 REFERENCE 9 (bases 1 to 1879) AUTHORS Han,J., Lee,J.D., Jiang,Y., Li,Z., Feng,L. and Ulevitch,R.J. TITLE Characterization of the structure and function of a novel MAP kinase kinase (MKK6) JOURNAL J. Biol. Chem. 271 (6), 2886-2891 (1996) PUBMED 8621675 REFERENCE 10 (bases 1 to 1879) AUTHORS Doza,Y.N., Cuenda,A., Thomas,G.M., Cohen,P. and Nebreda,A.R. TITLE Activation of the MAP kinase homologue RK requires the phosphorylation of Thr-180 and Tyr-182 and both residues are phosphorylated in chemically stressed KB cells JOURNAL FEBS Lett. 364 (2), 223-228 (1995) PUBMED 7750576 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DB111443.1, BC012009.1 and AA932919.1. This sequence is a reference standard in the RefSeqGene project. On Mar 27, 2006 this sequence version replaced gi:14589899. Summary: This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: U39657.1, U39656.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025087 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-90 DB111443.1 1-90 91-1553 BC012009.1 1-1463 1554-1879 AA932919.1 1-326 c FEATURES Location/Qualifiers source 1..1879 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="17" /map="17q24.3" gene 1..1879 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /note="mitogen-activated protein kinase kinase 6" /db_xref="GeneID:5608" /db_xref="HGNC:6846" /db_xref="HPRD:03155" /db_xref="MIM:601254" exon 1..304 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /inference="alignment:Splign:1.39.8" misc_feature 223..225 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /note="upstream in-frame stop codon" variation 238 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="c" /db_xref="dbSNP:371950957" variation 240 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="t" /db_xref="dbSNP:376268427" variation 283 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="g" /db_xref="dbSNP:201001185" variation 285 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="g" /db_xref="dbSNP:369288867" CDS 289..1293 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /EC_number="2.7.12.2" /note="protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6); MEK 6; MAPKK 6; MAPK/ERK kinase 6; SAPK kinase 3; stress-activated protein kinase kinase 3" /codon_start=1 /product="dual specificity mitogen-activated protein kinase kinase 6" /protein_id="NP_002749.2" /db_xref="GI:14589900" /db_xref="CCDS:CCDS11686.1" /db_xref="GeneID:5608" /db_xref="HGNC:6846" /db_xref="HPRD:03155" /db_xref="MIM:601254" /translation="
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
" misc_feature 298..345 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P52564.1); Region: D domain (By similarity)" misc_feature 328..333 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /experiment="experimental evidence, no additional details recorded" /note="Cleavage, by anthrax lethal factor; propagated from UniProtKB/Swiss-Prot (P52564.1); cleavage site" misc_feature 391..393 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" misc_feature 439..1287 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /note="Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6; Region: PKc_MKK3_6; cd06617" /db_xref="CDD:173729" misc_feature 448..1230 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /note="Serine/Threonine protein kinases, catalytic domain; Region: S_TKc; smart00220" /db_xref="CDD:197582" misc_feature order(451..453,457..459,463..486,490..492,496..498, 532..537,541..549,643..645,649..654,658..660,664..666, 679..693,712..714,835..840,844..846,874..876,889..891, 898..909,1282..1287) /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:173729" misc_feature order(463..477,481..483,487..489,526..528,532..534, 625..627,673..684,688..693,697..702,823..825,829..840, 844..846,877..879,886..888,925..936,940..942,1033..1035, 1060..1062) /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /note="active site" /db_xref="CDD:173729" misc_feature order(463..477,481..483,487..489,526..528,532..534, 625..627,673..684,688..693,697..702,829..831,835..840, 844..846,877..879) /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:173729" misc_feature order(472..477,823..825,829..837,886..888,925..936, 940..942,1033..1035,1060..1062) /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /note="substrate binding site [chemical binding]; other site" /db_xref="CDD:173729" misc_feature order(874..921,925..942) /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /note="activation loop (A-loop); other site" /db_xref="CDD:173729" misc_feature 907..909 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /experiment="experimental evidence, no additional details recorded" /note="O-acetylserine, by Yersinia yopJ, alternate; propagated from UniProtKB/Swiss-Prot (P52564.1); acetylation site" misc_feature 907..909 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine, by MAP3K, alternate; propagated from UniProtKB/Swiss-Prot (P52564.1); phosphorylation site" misc_feature 907..909 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /citation=[8] misc_feature 919..921 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /experiment="experimental evidence, no additional details recorded" /note="O-acetylthreonine, by Yersinia yopJ, alternate; propagated from UniProtKB/Swiss-Prot (P52564.1); acetylation site" misc_feature 919..921 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /experiment="experimental evidence, no additional details recorded" /note="Phosphothreonine, by MAP3K, alternate; propagated from UniProtKB/Swiss-Prot (P52564.1); phosphorylation site" misc_feature 919..921 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /citation=[8] misc_feature 1219..1290 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P52564.1); Region: DVD domain" exon 305..371 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /inference="alignment:Splign:1.39.8" variation 360 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:371065687" variation 371 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:201975195" exon 372..420 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /inference="alignment:Splign:1.39.8" variation 379 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="c" /db_xref="dbSNP:1133228" variation 411..412 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="" /replace="tt" /db_xref="dbSNP:10701683" variation 420 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:139570867" exon 421..534 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /inference="alignment:Splign:1.39.8" variation 454 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="t" /db_xref="dbSNP:200064105" variation 477 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:149312985" variation 483 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="g" /db_xref="dbSNP:368214335" variation 504 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="t" /db_xref="dbSNP:200217272" variation 513 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="t" /db_xref="dbSNP:192863519" variation 514 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:371754193" exon 535..654 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /inference="alignment:Splign:1.39.8" variation 571 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="t" /db_xref="dbSNP:144625593" variation 639 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="t" /db_xref="dbSNP:55977235" exon 655..771 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /inference="alignment:Splign:1.39.8" variation 718 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:373776681" variation 723 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="t" /db_xref="dbSNP:144096992" variation 756 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:185986382" exon 772..823 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /inference="alignment:Splign:1.39.8" exon 824..951 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /inference="alignment:Splign:1.39.8" variation 825 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="t" /db_xref="dbSNP:373722395" variation 858 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="t" /db_xref="dbSNP:148709755" variation 876 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="t" /db_xref="dbSNP:143627401" variation 903 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="g" /db_xref="dbSNP:375580762" variation 922 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:146813017" exon 952..1029 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /inference="alignment:Splign:1.39.8" variation 960 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:139650968" variation 977 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:201074921" variation 987 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:144298611" exon 1030..1169 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /inference="alignment:Splign:1.39.8" variation 1049 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:146595343" variation 1107 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="g" /db_xref="dbSNP:74734606" variation 1113 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:367955676" variation 1123 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="t" /db_xref="dbSNP:371824152" exon 1170..1215 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /inference="alignment:Splign:1.39.8" variation 1200 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:141053342" exon 1216..1869 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /inference="alignment:Splign:1.39.8" variation 1237 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="t" /db_xref="dbSNP:149844958" variation 1265 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="t" /db_xref="dbSNP:202101413" STS 1282..1503 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /standard_name="A005K40" /db_xref="UniSTS:17319" STS 1282..1503 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /standard_name="G20292" /db_xref="UniSTS:17318" variation 1301 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="t" /db_xref="dbSNP:372722559" variation 1312 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:377469891" variation 1325 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:370917523" variation 1342 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:201121602" STS 1347..1530 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /standard_name="D17S1471E" /db_xref="UniSTS:151679" polyA_signal 1531..1536 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" variation 1538 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="a" /replace="g" /db_xref="dbSNP:61759602" polyA_site 1566 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" variation 1713 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="c" /replace="t" /db_xref="dbSNP:192617996" variation 1739 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="" /replace="c" /db_xref="dbSNP:200853345" variation 1740 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="" /replace="a" /db_xref="dbSNP:58590521" variation 1748 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" /replace="" /replace="a" /db_xref="dbSNP:374066307" polyA_site 1869 /gene="MAP2K6" /gene_synonym="MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3" ORIGIN
agttccaagtttggagcttttagctgccagccctggcccatcatgtagctgcagcacagccttccctaacgttgcaactgggggaaaaatcactttccagtctgttttgcaaggtgtgcatttccatcttgattccctgaaagtccatctgctgcatcggtcaagagaaactccacttgcatgaagattgcacgcctgcagcttgcatctttgttgcaaaactagctacagaagagaagcaaggcaaagtcttttgtgctcccctcccccatcaaaggaaaggggaaaatgtctcagtcgaaaggcaagaagcgaaaccctggccttaaaattccaaaagaagcatttgaacaacctcagaccagttccacaccacctcgagatttagactccaaggcttgcatttctattggaaatcagaactttgaggtgaaggcagatgacctggagcctataatggaactgggacgaggtgcgtacggggtggtggagaagatgcggcacgtgcccagcgggcagatcatggcagtgaagcggatccgagccacagtaaatagccaggaacagaaacggctactgatggatttggatatttccatgaggacggtggactgtccattcactgtcaccttttatggcgcactgtttcgggagggtgatgtgtggatctgcatggagctcatggatacatcactagataaattctacaaacaagttattgataaaggccagacaattccagaggacatcttagggaaaatagcagtttctattgtaaaagcattagaacatttacatagtaagctgtctgtcattcacagagacgtcaagccttctaatgtactcatcaatgctctcggtcaagtgaagatgtgcgattttggaatcagtggctacttggtggactctgttgctaaaacaattgatgcaggttgcaaaccatacatggcccctgaaagaataaacccagagctcaaccagaagggatacagtgtgaagtctgacatttggagtctgggcatcacgatgattgagttggccatccttcgatttccctatgattcatggggaactccatttcagcagctcaaacaggtggtagaggagccatcgccacaactcccagcagacaagttctctgcagagtttgttgactttacctcacagtgcttaaagaagaattccaaagaacggcctacatacccagagctaatgcaacatccatttttcaccctacatgaatccaaaggaacagatgtggcatcttttgtaaaactgattcttggagactaaaaagcagtggacttaatcggttgaccctactgtggattggtgggtttcggggtgaagcaagttcactacagcatcaatagaaagtcatctttgagataatttaaccctgcctctcagagggttttctctcccaattttctttttactccccctcttaagggggccttggaatctatagtatagaatgaactgtctagatggatgaattatgataaaggcttaggacttcaaaaggtgattaaatatttaatgatgtgtcatatgagtcctcaagcttctcagacttctcttattctttacaaaatgaatgcattggccctgacaaaaaggtgctacggtagtgatgaaattataagtagatttgtagtttgtcccatttattattttaatatttatgtttaagtgcttggttgaaaagattccattttatacaagaagggagattcaaaaaaaaaatataaggttgggttagcaatatttatagggcttttattttttaagttcaattgtgtctgtggtccagaagaaattatttaatatgcatctttgagaatattataaaaatatcaaaaaggaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:5608 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IEA GeneID:5608 -> Molecular function: GO:0004708 [MAP kinase kinase activity] evidence: TAS GeneID:5608 -> Molecular function: GO:0004713 [protein tyrosine kinase activity] evidence: IEA GeneID:5608 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:5608 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA GeneID:5608 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI GeneID:5608 -> Biological process: GO:0000187 [activation of MAPK activity] evidence: TAS GeneID:5608 -> Biological process: GO:0002224 [toll-like receptor signaling pathway] evidence: TAS GeneID:5608 -> Biological process: GO:0002755 [MyD88-dependent toll-like receptor signaling pathway] evidence: TAS GeneID:5608 -> Biological process: GO:0002756 [MyD88-independent toll-like receptor signaling pathway] evidence: TAS GeneID:5608 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA GeneID:5608 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IEA GeneID:5608 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:5608 -> Biological process: GO:0006975 [DNA damage induced protein phosphorylation] evidence: TAS GeneID:5608 -> Biological process: GO:0007050 [cell cycle arrest] evidence: TAS GeneID:5608 -> Biological process: GO:0007165 [signal transduction] evidence: TAS GeneID:5608 -> Biological process: GO:0034134 [toll-like receptor 2 signaling pathway] evidence: TAS GeneID:5608 -> Biological process: GO:0034138 [toll-like receptor 3 signaling pathway] evidence: TAS GeneID:5608 -> Biological process: GO:0034142 [toll-like receptor 4 signaling pathway] evidence: TAS GeneID:5608 -> Biological process: GO:0034146 [toll-like receptor 5 signaling pathway] evidence: TAS GeneID:5608 -> Biological process: GO:0034162 [toll-like receptor 9 signaling pathway] evidence: TAS GeneID:5608 -> Biological process: GO:0034166 [toll-like receptor 10 signaling pathway] evidence: TAS GeneID:5608 -> Biological process: GO:0035666 [TRIF-dependent toll-like receptor signaling pathway] evidence: TAS GeneID:5608 -> Biological process: GO:0035872 [nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway] evidence: TAS GeneID:5608 -> Biological process: GO:0038123 [toll-like receptor TLR1:TLR2 signaling pathway] evidence: TAS GeneID:5608 -> Biological process: GO:0038124 [toll-like receptor TLR6:TLR2 signaling pathway] evidence: TAS GeneID:5608 -> Biological process: GO:0042493 [response to drug] evidence: IEA GeneID:5608 -> Biological process: GO:0042692 [muscle cell differentiation] evidence: TAS GeneID:5608 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IEA GeneID:5608 -> Biological process: GO:0045087 [innate immune response] evidence: TAS GeneID:5608 -> Biological process: GO:0051149 [positive regulation of muscle cell differentiation] evidence: TAS GeneID:5608 -> Biological process: GO:0051403 [stress-activated MAPK cascade] evidence: TAS GeneID:5608 -> Biological process: GO:0060048 [cardiac muscle contraction] evidence: IEA GeneID:5608 -> Biological process: GO:0070423 [nucleotide-binding oligomerization domain containing signaling pathway] evidence: TAS GeneID:5608 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS GeneID:5608 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:5608 -> Cellular component: GO:0005856 [cytoskeleton] evidence: IEA ANNOTATIONS from NCBI Entrez Gene (20130726): NP_002749 -> EC 2.7.12.2
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.