GGRNA Home | Help | Advanced search

2020-10-26 19:52:52, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_002655               7338 bp    mRNA    linear   PRI 06-MAY-2013
DEFINITION  Homo sapiens pleiomorphic adenoma gene 1 (PLAG1), transcript
            variant 1, mRNA.
ACCESSION   NM_002655 XM_937873
VERSION     NM_002655.2  GI:167857793
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 7338)
  AUTHORS   Akhtar,M., Holmgren,C., Gondor,A., Vesterlund,M., Kanduri,C.,
            Larsson,C. and Ekstrom,T.J.
  TITLE     Cell type and context-specific function of PLAG1 for IGF2 P3
            promoter activity
  JOURNAL   Int. J. Oncol. 41 (6), 1959-1966 (2012)
   PUBMED   23023303
  REMARK    GeneRIF: PLAG1 binding to the IGF2 P3 promoter and IGF2 expression
            is cell type-specific, and that the PLAG1 transcription factor acts
            as a transcriptional facilitator that partially overrides the
            insulation by the H19 ICR.
REFERENCE   2  (bases 1 to 7338)
  AUTHORS   Bahrami,A., Dalton,J.D., Shivakumar,B. and Krane,J.F.
  TITLE     PLAG1 alteration in carcinoma ex pleomorphic adenoma:
            immunohistochemical and fluorescence in situ hybridization studies
            of 22 cases
  JOURNAL   Head Neck Pathol 6 (3), 328-335 (2012)
   PUBMED   22485045
  REMARK    GeneRIF: We conclude that most Carcinoma ex pleomorphic adenoma,
            regardless of morphologic subtype,carry altered PLAG1 genes
REFERENCE   3  (bases 1 to 7338)
  AUTHORS   Friedrich,R.E., Dilcher,J., Jaehne,M. and Loning,T.
  TITLE     Chromosomal rearrangements in PLAG1 of myoepithelial salivary gland
            tumours
  JOURNAL   Anticancer Res. 32 (5), 1977-1981 (2012)
   PUBMED   22593475
  REMARK    GeneRIF: PLAG1 is evidently not involved in the development of
            myoepithelial tumours. The proportion of 8q12-alterations in
            myoepithelial tumours was very low.
REFERENCE   4  (bases 1 to 7338)
  AUTHORS   Bahrami,A., Dalton,J.D., Krane,J.F. and Fletcher,C.D.
  TITLE     A subset of cutaneous and soft tissue mixed tumors are genetically
            linked to their salivary gland counterpart
  JOURNAL   Genes Chromosomes Cancer 51 (2), 140-148 (2012)
   PUBMED   22038920
  REMARK    GeneRIF: myoepithelial tumors with PLAG1 alteration share a common
            morphologic phenotype with salivary gland-like morphology and are
            genetically related to their salivary gland counterpart
REFERENCE   5  (bases 1 to 7338)
  AUTHORS   Matsuyama,A., Hisaoka,M. and Hashimoto,H.
  TITLE     PLAG1 expression in mesenchymal tumors: an immunohistochemical
            study with special emphasis on the pathogenetical distinction
            between soft tissue myoepithelioma and pleomorphic adenoma of the
            salivary gland
  JOURNAL   Pathol. Int. 62 (1), 1-7 (2012)
   PUBMED   22192798
  REMARK    GeneRIF: PLAG1 immunohistochemistry is useful for distinguishing
            lipoblastoma from other lipomatous tumors including liposarcoma.
REFERENCE   6  (bases 1 to 7338)
  AUTHORS   Astrom,A.K., Voz,M.L., Kas,K., Roijer,E., Wedell,B., Mandahl,N.,
            Van de Ven,W., Mark,J. and Stenman,G.
  TITLE     Conserved mechanism of PLAG1 activation in salivary gland tumors
            with and without chromosome 8q12 abnormalities: identification of
            SII as a new fusion partner gene
  JOURNAL   Cancer Res. 59 (4), 918-923 (1999)
   PUBMED   10029085
REFERENCE   7  (bases 1 to 7338)
  AUTHORS   Kas,K., Voz,M.L., Hensen,K., Meyen,E. and Van de Ven,W.J.
  TITLE     Transcriptional activation capacity of the novel PLAG family of
            zinc finger proteins
  JOURNAL   J. Biol. Chem. 273 (36), 23026-23032 (1998)
   PUBMED   9722527
REFERENCE   8  (bases 1 to 7338)
  AUTHORS   Voz,M.L., Astrom,A.K., Kas,K., Mark,J., Stenman,G. and Van de
            Ven,W.J.
  TITLE     The recurrent translocation t(5;8)(p13;q12) in pleomorphic adenomas
            results in upregulation of PLAG1 gene expression under control of
            the LIFR promoter
  JOURNAL   Oncogene 16 (11), 1409-1416 (1998)
   PUBMED   9525740
REFERENCE   9  (bases 1 to 7338)
  AUTHORS   Kas,K., Roijer,E., Voz,M., Meyen,E., Stenman,G. and Van de Ven,W.J.
  TITLE     A 2-Mb YAC contig and physical map covering the chromosome 8q12
            breakpoint cluster region in pleomorphic adenomas of the salivary
            glands
  JOURNAL   Genomics 43 (3), 349-358 (1997)
   PUBMED   9268638
REFERENCE   10 (bases 1 to 7338)
  AUTHORS   Kas,K., Voz,M.L., Roijer,E., Astrom,A.K., Meyen,E., Stenman,G. and
            Van de Ven,W.J.
  TITLE     Promoter swapping between the genes for a novel zinc finger protein
            and beta-catenin in pleiomorphic adenomas with t(3;8)(p21;q12)
            translocations
  JOURNAL   Nat. Genet. 15 (2), 170-174 (1997)
   PUBMED   9020842
  REMARK    Erratum:[Nat Genet 1997 Apr;15(4):411]
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DA225321.1, U65002.1 and
            AC107952.5.
            This sequence is a reference standard in the RefSeqGene project.
            On Feb 14, 2008 this sequence version replaced gi:4505854.
            
            Summary: Pleomorphic adenoma gene 1 encodes a zinc finger protein
            with 2 putative nuclear localization signals. PLAG1, which is
            developmentally regulated, has been shown to be consistently
            rearranged in pleomorphic adenomas of the salivary glands. PLAG1 is
            activated by the reciprocal chromosomal translocations involving
            8q12 in a subset of salivary gland pleomorphic adenomas. Three
            transcript variants encoding two different isoforms have been found
            for this gene. [provided by RefSeq, Jul 2008].
            
            Transcript Variant: This variant (1) represents the longest
            transcript and encodes the longer isoform (a). Variants 1 and 2
            both encode the same isoform.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data because no single transcript was available
            for the full length of the gene. The extent of this transcript is
            supported by transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U65002.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025083, ERS025085 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-21                DA225321.1         1-21
            22-1872             U65002.1           1-1851
            1873-7338           AC107952.5         24501-29966         c
FEATURES             Location/Qualifiers
     source          1..7338
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /map="8q12"
     gene            1..7338
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /note="pleiomorphic adenoma gene 1"
                     /db_xref="GeneID:5324"
                     /db_xref="HGNC:9045"
                     /db_xref="MIM:603026"
     exon            1..180
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /inference="alignment:Splign:1.39.8"
     exon            181..285
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /inference="alignment:Splign:1.39.8"
     exon            286..384
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /inference="alignment:Splign:1.39.8"
     exon            385..743
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /inference="alignment:Splign:1.39.8"
     STS             460..2024
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /db_xref="UniSTS:482309"
     misc_feature    493..495
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /note="upstream in-frame stop codon"
     CDS             502..2004
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /note="isoform a is encoded by transcript variant 1; zinc
                     finger protein PLAG1; COL1A2/PLAG1 fusion"
                     /codon_start=1
                     /product="zinc finger protein PLAG1 isoform a"
                     /protein_id="NP_002646.2"
                     /db_xref="GI:167857794"
                     /db_xref="CCDS:CCDS6165.1"
                     /db_xref="GeneID:5324"
                     /db_xref="HGNC:9045"
                     /db_xref="MIM:603026"
                     /translation="
MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKETFKCEECGKNYNTKLGFKRHLALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSGGVKEKKHQCEHCDRRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQELLKVKTEPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQSSGSAHQMITTLPLGMTCPIDMDTVHPSHHLSFKYPFSSTSYAISIPEKEQPLKGEIESYLMELQGGVPSSSQDSQASSSSKLGLDPQIGSLDDGAGDLSLSKSSISISDPLNTPALDFSQLFNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPPQTQDLQDPANTIGLGSLHSLSAAFTSSLSTSTTLPRFHQAFQ
"
     misc_feature    505..753
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6DJT9.1);
                     Region: Interacts with KPNA2"
     misc_feature    565..576
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6DJT9.1);
                     Region: Nuclear localization signal"
     misc_feature    622..1227
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6DJT9.1);
                     Region: Decreased nuclear import with localization in the
                     nucleus but also in the cytoplasm"
     misc_feature    646..726
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /note="Zinc-finger double domain; Region: zf-H2C2_2;
                     pfam13465"
                     /db_xref="CDD:205643"
     misc_feature    736..810
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /note="Zinc-finger double domain; Region: zf-H2C2_2;
                     pfam13465"
                     /db_xref="CDD:205643"
     misc_feature    1228..2001
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6DJT9.1);
                     Region: Activates transcription, Inhibition of nuclear
                     import due to lack of NLS and KPNA2 interaction"
     misc_feature    1228..1653
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6DJT9.1);
                     Region: Repression domain, contains 3 sumoylation motifs
                     and massively decrease transcription activity"
     misc_feature    1654..2001
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6DJT9.1);
                     Region: Massively activates transcription"
     exon            744..7338
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /inference="alignment:Splign:1.39.8"
     STS             3485..3631
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /standard_name="RH12848"
                     /db_xref="UniSTS:31562"
     variation       3540
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:15584"
     variation       4427
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1128143"
     variation       4565
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1128144"
     variation       4584
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1128145"
     STS             4728..4904
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /standard_name="A009Z02"
                     /db_xref="UniSTS:41375"
     STS             4728..4904
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /standard_name="G33002"
                     /db_xref="UniSTS:117579"
     STS             4861..5010
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
                     /standard_name="SGC34502"
                     /db_xref="UniSTS:2867"
     polyA_signal    7316..7321
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
     polyA_site      7338
                     /gene="PLAG1"
                     /gene_synonym="PSA; SGPA; ZNF912"
ORIGIN      
agctgcaagttgggctgcaggggcagcgcatacactacaatggctgctggaaagaggcgtaaggaaacaatttccaggcccgccgcgtccagcccgaaatatgagaaaaaaattattagaaattccgcgggcggtgtagaggcggcggacgggccggagggaggatgttaaagccccgcggttgcctcttggtgctgccttggccgtatttggcacccagaatgcttcattctgtgacggtctattaataaggttgccttgctagagtttggagcagggcctcagattggccaaaatgggaaggattggattccactctcttccacgaagagtcaatgggactggctaagatcaaagtctgaggctttttccatcagtaatcagtccctttttgctttcttttacgaccacatgaaacttgagaagccacctaaagctatatcatttagtggagttgggcagttcccaagtgtccaacaagaaggcctggtttaggctgcgatggccactgtcattcctggtgatttgtcagaagtaagagatacccagaaagtcccttcagggaaacgtaagcgtggtgaaaccaaaccaagaaaaaactttccttgccaactgtgtgacaaggcctttaacagtgttgagaaattaaaggttcactcctactctcacacaggagagaggccctacaagtgcatacaacaagactgcaccaaggcctttgtttctaagtacaaattacaaaggcacatggctactcattctcctgagaaaacccacaagtgtaattattgtgagaaaatgtttcaccggaaagatcatctgaagaatcacctccatacacacgaccctaacaaagagacgtttaagtgcgaagaatgtggcaagaactacaataccaagcttggatttaaacgtcacttggccttgcatgccgcaacaagtggtgacctcacctgtaaggtatgtttgcaaacttttgaaagcacgggagtgcttctggagcaccttaaatctcatgcaggcaagtcgtctggtggggttaaagaaaaaaagcaccagtgcgaacattgtgatcgccggttctacacccgaaaggatgtccggagacacatggtggtgcacactggaagaaaggacttcctctgtcagtattgtgcacagagatttgggcgaaaggatcacctgactcgacatatgaagaagagtcacaatcaagagcttctgaaggtcaaaacagaaccagtggatttccttgacccatttacctgcaatgtgtctgtgcctataaaagacgagctccttccggtgatgtccttaccttccagtgaactgttatcaaagccattcacaaacactttgcagttaaacctctacaacactccatttcagtccatgcagagctcgggatctgcccaccaaatgatcacaactttacctttgggaatgacatgcccaatagatatggacactgttcatccctctcaccacctttctttcaaatatccgttcagttctacctcatatgcaatttctattcctgaaaaagaacagccattaaagggggaaattgagagttacctgatggagttacaaggtggcgtgccctcttcatcccaagattctcaagcatcgtcatcatctaagctagggttggatcctcagattgggtccctagatgatggtgcaggagacctctccctatccaaaagctctatctccatcagtgaccccctaaacacaccagcattggatttttctcagttgtttaatttcatacctttaaatggtcctccctataatcctctatcagtggggagccttggaatgagctattcccaggaagaagcacattcttctgtttcccagctccccccacaaacacaggatcttcaggatcctgcaaacactatagggcttgggtctctgcactcactgtcagcagctttcaccagcagtttaagcacaagtaccaccctcccacgtttccatcaagcttttcagtaggattctgggacatggattcattacagaaatgtatgtgtagctgtgccctagatgaccatttttattttagtgcctactttaaaacagtataaaaatttctgcttttgtataatacaaattttcattaagccagtataaaatagaaactagcttttaaactgagctttggaaccatttgtgttcagttaagtttacctgggtattttgtcctgattcactgccaattgtcacattttaagacttttttttttccatataggaaagccattattagtagtaaacttttacaaatcccattttcaaattacttttagatcttaaaattttcatttttgtctaataacagtggctctaccttttgacatctggctcattaaaaaatttagcaatagaatgtaaattgtataaaaagtttgtgaataactcaagggtttaaattttcttactagcttctaaatggattaataatcaagtgcttcaaatgaattaagagtccagtttcggaagataataaatgtttgttagatacaccataatttcagatcagtatattctgaagactccctgttgtctggctaaaatatttgccatctttattatgagcctttaaggaaaacaaaccctaaacacaaagcatcagtatttatagcaaaaagagactctgttaggtgacatggcatttcgtgtcacttaatagttggccctaaattagtacacaggatattttgtcgtgtttcatccttcttaacatgctatcttttcatttaataatagtaatagtgtatggcattggggtcttcagagtcgatatataggtagatctctttagtcttttccacctttcacatccaaggggtgggtcaagtgcagccagcaatttattttcattgttggcccacggttagtccataatctagagccattgtggaactgcagccatgaggtgtgtttatcccacagtggattgactcagcctctgtgggtgacagacttctaagcaggaagatagacgtgaagcacatggttacatttgggaacttgtgtagggatcatggcccctgtagccagggttaaaaactggactttttagaagtaaagtaaaagcatatcgcttatatcatttcttgctgaatttgatatgtttttctttcccttaagaatcaaaagcagaaaacaaaaacaacagtcctactccgatgttatctttctgattcaatgtgaatccatctttccttgcaatattttggatggagaatttgaagttaaatgcattagaaaactacctgatgaactaccacaaagttttaagtgactagaaatatatacagtaaaatcccactttcatgcatctctgggaaatgataggagtattgcaaataagttgagtttgtagagggtaacaaagtaaagtaaaacaaacctatcttggttaacatgaaaataacaattgagaatatattatattcactgaataattataggcttttcctcacattagacaaccaacataatcttcttaaaggtctaattaatatatttttctaagggtcagttgggacattaacctaagaaacatatctattaagcacttgttaacaccttattttaggaccctttccgttggggatgggggcaagggtgggaggtttttagaagagtatatatctctttaaaaaaaaacagaaagaaaaatatttctgagcactcattagccctatatggaaacttctttcctttttgtagggccagttatcactgcagattgcaatgtttaccaagaatttctaaaaatgagtgcagattactgaatataatacattatttaaaatatttgggagtagtataatttgtggagaaatgtaaattgtaataatgtaaatgggggcttcaatatatatatataatacacacacacacacacatgcacacataccgcacttcatagaatcaaagttgctctctgaaggagctttggctcctgatattttatcatgctcctatatttttttaatccttggagcagtagtttttatacttatgtatttaaattttattatgaaaaattacatttattaaaaaagtgtgttccaaaggcattaaaattatatatgttaataaggaagtacatttttaaatttttcaaactgctcctagcttttgattaggagaatattttttctgaaagtaggcttttcgctctgcttcattactgcttcctttagtttctatgaaacagattgcttacctaaatctttagttgaatgattagtgttcaatattgctttaatcaccatataaaaggaaaaaaattggtgacagagcacaaatagaaaacctatttttaaatagaaatcacaaatagcaagtgtggaagcactactttattctgtttaaaatgtacttaagaagtcatcaaattagtgaactgagacattggccttagtaggctgtattcactgctaatttaaaaaagggagtaccaggatttattaagtaaagcattttggaaatggggaatagcgccatatatgtatgtatgtgtatgtgtgtgtgtgtgtgtgtatatatacacacacacacacatacttaaatcttgccctgcatgaaattcaaatacatggaggcacatcttcagggcaccagtgttaaaattttggagtcttaattttcatgtgtacacctctttgcctgttcccacccccagacttgaaataacacttcagagtaagagggaattcagctaatttgtttttaaaattgactgtagtggtcactaaaccctttttgagagaatttctattaaagatgaggcagactcgcttatttgaattgcacaatgttctaacaaggatgtaacacagaattggcttttttttccctagaaaaagattgtttgtttctatgtcaactagatatgattaaaaataagtattgccaatgctgttttcattctctagtggccagaatcattatccttgaaatttctggtagtgccttagcttggttaaaaaaaaaaaaaaaaaaaaaaaaaagggattaacattaaataaaagtagtttagaatttgggcctcagacaagatattgaacctcattcagtttcacttccacatgtatgtacaagttaggtcaccaaacacggaagtgtgagtgtggaaggatcttggcactgtaagcaatgctatccattgatgtatacaagtacctttatagttatcgatcactgttaaaactttcattttaaaatcctattaccaagttcagttttttaaaacttcaattgtcctggctgattatgcatcactctgtgtgcaacttttttatttcatttagtgtttctttcaagctgtgtatttttgcctatttgttgcttgtgctttatttttcttagtcatttgtggaatatagtgatatattgtgttaatttggacagtagcggtttttaaaaaccatatactgactgaaacatgagccagagccgattgctttattaagctaataatgaatgttaaagagtacatattttcaggatcgttcatctagtgagcaatacacatattataggccaatatttttttaaaaaatagagcttggtcaacctctatactacacatattacaagatatagcactttcaaaatgaatctaaacctttacagaaactttcttataggttatgccttttattttaagacttattataattcaagtgccattagatgatatatatgtaggcctttgatatataatgctttgtgtacaaaaatggtagatggtattttaaacaggtacatttttacagtgttttcttatcaatttgctatattgcacagaatcagtgtgtgtcttttcataaggttttacaatggtttatttttttacaaggtttacgtgtctcaaagcacactgtcttcccagtacgtaagttaaaaaataccagttcacccaagttgcttctagcctactgagatccatgtgacattggaggagatcttttaaatgtttagtattcgtcattagcaatggctggctgttagttctggtaaatgtgtgcctaagttgaatttgtcttgtttttctcacactgtgtcagcagccatgtctacaacacagataagtctgttgtgatcacatagatctacataagttgtgcagttttgtgctaaaaacccatagggagctcctttgggatcatagaaaagaagatcatgcaaccagcattggtgaaggcacactcagattgcacttagggcctttctatgatgttgtcaaccctctgaggatggaaggcagtgtcttttgatgttatctagcctagaaatgacacagaactattgctaatgtataaaacacttcattatataagcttcagtggtacagatgaaccagaatgaatgtttatcttctcagaaacactccttcaatattatattggatcatgctgctaatgtaacttgggctacaactcttcatggtgctacaaacttctctgtctcattcagtcgtatttttttatccatagaaaaaggactacattaggtgtaaaagtgtacaatatatttttatactgtgacttaatttgtcattaacaaacttttacaccaccacaatgtattcatgtgcacttgcaaaaggagatctcggacatgcaaatgttaccagaacaaacccagcttttgtccacaaggtgactgtaactcagaatggaaagtgggctttataatagggtgtggagtgaagaacatgctgtatgttactaacagccctttgaatttaacaaaaactgggaatccattaggaaacggattgcatcatacctgaacataagctggactgctgaaattgtatttttagctaatgaaaaagtgtttggactagtactctaaaaatgttctaatgataaagttttgagtcaaaatagaaaagaaaaaaatctgcattccaggccgaattttgtatatttttattgcatttaaaattgctattctgtaatattgggaaatcaagtggcttatcatgtatatcgtgtacttaaaatgtattcacaaactactgttgtatttgtataaaatatagacaaagatcatattttttgtgtgtgtataagctctgtaaaatagcaatcacattatgaagctgcagtgatactacattttaaacattcacatccaaagaagcagactatttattgtccatataccagatttaaaatattaatttgctgctaattaaataatagtactgcagcttcttgtggcctacagtgttatgtttgctgtaagaataagatatgtgaattccacaaaatatatgaataaaattatagaatggcttta
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:5324 -> Molecular function: GO:0000981 [sequence-specific DNA binding RNA polymerase II transcription factor activity] evidence: IBA
            GeneID:5324 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA
            GeneID:5324 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: TAS
            GeneID:5324 -> Molecular function: GO:0046872 [metal ion binding] evidence: IEA
            GeneID:5324 -> Biological process: GO:0006357 [regulation of transcription from RNA polymerase II promoter] evidence: IBA
            GeneID:5324 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IBA
            GeneID:5324 -> Biological process: GO:0010628 [positive regulation of gene expression] evidence: IEA
            GeneID:5324 -> Biological process: GO:0010629 [negative regulation of gene expression] evidence: IEA
            GeneID:5324 -> Biological process: GO:0022612 [gland morphogenesis] evidence: IEA
            GeneID:5324 -> Biological process: GO:0035264 [multicellular organism growth] evidence: IEA
            GeneID:5324 -> Biological process: GO:0035265 [organ growth] evidence: IEA
            GeneID:5324 -> Biological process: GO:0060252 [positive regulation of glial cell proliferation] evidence: IEA
            GeneID:5324 -> Biological process: GO:0060736 [prostate gland growth] evidence: IEA
            GeneID:5324 -> Cellular component: GO:0005634 [nucleus] evidence: IBA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.