2024-03-29 06:26:57, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002583 1967 bp mRNA linear PRI 07-JUL-2013 DEFINITION Homo sapiens PRKC, apoptosis, WT1, regulator (PAWR), mRNA. ACCESSION NM_002583 VERSION NM_002583.2 GI:55769532 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1967) AUTHORS Burikhanov,R., Shrestha-Bhattarai,T., Qiu,S., Shukla,N., Hebbar,N., Lele,S.M., Horbinski,C. and Rangnekar,V.M. TITLE Novel mechanism of apoptosis resistance in cancer mediated by extracellular PAR-4 JOURNAL Cancer Res. 73 (2), 1011-1019 (2013) PUBMED 23204231 REMARK GeneRIF: our results identify a novel intracellular pathway of apoptosis mediated by NF-kappaB through UACA elevation, which by attenuating endoplasmic reticulum stress and GRP78 translocation to the cell surface can blunt the sensitivity of cancer cells to apoptosis. REFERENCE 2 (bases 1 to 1967) AUTHORS Wang,G., Dinkins,M., He,Q., Zhu,G., Poirier,C., Campbell,A., Mayer-Proschel,M. and Bieberich,E. TITLE Astrocytes secrete exosomes enriched with proapoptotic ceramide and prostate apoptosis response 4 (PAR-4): potential mechanism of apoptosis induction in Alzheimer disease (AD) JOURNAL J. Biol. Chem. 287 (25), 21384-21395 (2012) PUBMED 22532571 REMARK GeneRIF: a novel mechanism of apoptosis induction by PAR-4/ceramide-enriched exosomes, which may critically contribute to Alzheimer disease. REFERENCE 3 (bases 1 to 1967) AUTHORS Wang,Y., Moreland,M., Wagner,J.G., Ames,B.N., Illek,B., Peden,D.B. and Jiang,Q. TITLE Vitamin E forms inhibit IL-13/STAT6-induced eotaxin-3 secretion by up-regulation of PAR4, an endogenous inhibitor of atypical PKC in human lung epithelial cells JOURNAL J. Nutr. Biochem. 23 (6), 602-608 (2012) PUBMED 21764283 REMARK GeneRIF: Gamma-tocotrienol inhibited IL-13/STAT6-activated eotaxin secretion via up-regulation of PAR4 expression and enhancement of aPKC-PAR4 complex formation. REFERENCE 4 (bases 1 to 1967) AUTHORS Chaudhry,P., Singh,M., Parent,S. and Asselin,E. TITLE Prostate apoptosis response 4 (Par-4), a novel substrate of caspase-3 during apoptosis activation JOURNAL Mol. Cell. Biol. 32 (4), 826-839 (2012) PUBMED 22184067 REMARK GeneRIF: identified a novel specific caspase-3 cleavage site in Par-4, and the cleaved fragment of Par-4 retains proapoptotic activity REFERENCE 5 (bases 1 to 1967) AUTHORS Casolari,D.A., Pereira,M.C., de Bessa Garcia,S.A. and Nagai,M.A. TITLE Insulin-like growth factor-1 and 17beta-estradiol down-regulate prostate apoptosis response-4 expression in MCF-7 breast cancer cells JOURNAL Int. J. Mol. Med. 28 (3), 337-342 (2011) PUBMED 21567071 REMARK GeneRIF: 17beta-estradiol and Insulin-like growth factor-1 inhibit PAR-4 gene expression in MCF-7 cells. REFERENCE 6 (bases 1 to 1967) AUTHORS Guo,Q., Xie,J., Chang,X. and Du,H. TITLE Prostate apoptosis response-4 enhances secretion of amyloid beta peptide 1-42 in human neuroblastoma IMR-32 cells by a caspase-dependent pathway JOURNAL J. Biol. Chem. 276 (19), 16040-16044 (2001) PUBMED 11278808 REMARK GeneRIF: Par-4 increases secretion of amyloid beta peptide 1-42, which contributes to the pathogenesis of Alzheimer's disease. REFERENCE 7 (bases 1 to 1967) AUTHORS Kruman,I.I., Nath,A., Maragos,W.F., Chan,S.L., Jones,M., Rangnekar,V.M., Jakel,R.J. and Mattson,M.P. TITLE Evidence that Par-4 participates in the pathogenesis of HIV encephalitis JOURNAL Am. J. Pathol. 155 (1), 39-46 (1999) PUBMED 10393834 REFERENCE 8 (bases 1 to 1967) AUTHORS Johnstone,R.W., Tommerup,N., Hansen,C., Vissing,H. and Shi,Y. TITLE Mapping of the human PAWR (par-4) gene to chromosome 12q21 JOURNAL Genomics 53 (2), 241-243 (1998) PUBMED 9790775 REFERENCE 9 (bases 1 to 1967) AUTHORS Guo,Q., Fu,W., Xie,J., Luo,H., Sells,S.F., Geddes,J.W., Bondada,V., Rangnekar,V.M. and Mattson,M.P. TITLE Par-4 is a mediator of neuronal degeneration associated with the pathogenesis of Alzheimer disease JOURNAL Nat. Med. 4 (8), 957-962 (1998) PUBMED 9701251 REMARK GeneRIF: Par-4 expression is increased in vulnerable neurons in Alzheimer's disease, and contributes to apoptotic neuronal cell death in the disease. REFERENCE 10 (bases 1 to 1967) AUTHORS Johnstone,R.W., See,R.H., Sells,S.F., Wang,J., Muthukkumar,S., Englert,C., Haber,D.A., Licht,J.D., Sugrue,S.P., Roberts,T., Rangnekar,V.M. and Shi,Y. TITLE A novel repressor, par-4, modulates transcription and growth suppression functions of the Wilms' tumor suppressor WT1 JOURNAL Mol. Cell. Biol. 16 (12), 6945-6956 (1996) PUBMED 8943350 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CN280333.1, BC007018.1, U63809.1 and CA313080.1. On Nov 15, 2004 this sequence version replaced gi:4505612. Summary: The tumor suppressor WT1 represses and activates transcription. The protein encoded by this gene is a WT1-interacting protein that itself functions as a transcriptional repressor. It contains a putative leucine zipper domain which interacts with the zinc finger DNA binding domain of WT1. This protein is specifically upregulated during apoptosis of prostate cells. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: U63809.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-421 CN280333.1 4-424 422-882 BC007018.1 268-728 883-1127 U63809.1 841-1085 1128-1662 BC007018.1 974-1508 1663-1672 U63809.1 1621-1630 1673-1950 BC007018.1 1520-1797 1951-1967 CA313080.1 1-17 c FEATURES Location/Qualifiers source 1..1967 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="12" /map="12q21" gene 1..1967 /gene="PAWR" /gene_synonym="Par-4; PAR4" /note="PRKC, apoptosis, WT1, regulator" /db_xref="GeneID:5074" /db_xref="HGNC:8614" /db_xref="MIM:601936" exon 1..139 /gene="PAWR" /gene_synonym="Par-4; PAR4" /inference="alignment:Splign:1.39.8" exon 140..802 /gene="PAWR" /gene_synonym="Par-4; PAR4" /inference="alignment:Splign:1.39.8" misc_feature 254..256 /gene="PAWR" /gene_synonym="Par-4; PAR4" /note="upstream in-frame stop codon" CDS 287..1309 /gene="PAWR" /gene_synonym="Par-4; PAR4" /note="transcriptional repressor PAR4; WT1-interacting protein; prostate apoptosis response protein 4; prostate apoptosis response protein PAR-4; prostate apoptosis response 4 protein; prostate apoptosis response-4" /codon_start=1 /product="PRKC apoptosis WT1 regulator protein" /protein_id="NP_002574.2" /db_xref="GI:55769533" /db_xref="CCDS:CCDS31863.1" /db_xref="GeneID:5074" /db_xref="HGNC:8614" /db_xref="MIM:601936" /translation="
MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR
" misc_feature 719..895 /gene="PAWR" /gene_synonym="Par-4; PAR4" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q96IZ0.1); Region: Selective for apoptosis induction in cancer cells (SAC)" misc_feature 719..769 /gene="PAWR" /gene_synonym="Par-4; PAR4" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q96IZ0.1); Region: Nuclear localization signal (By similarity)" misc_feature 1088..>1279 /gene="PAWR" /gene_synonym="Par-4; PAR4" /note="Plant protein of unknown function (DUF869); Region: DUF869; pfam05911" /db_xref="CDD:203347" misc_feature 1184..1306 /gene="PAWR" /gene_synonym="Par-4; PAR4" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q96IZ0.1); Region: Leucine-zipper" variation 411 /gene="PAWR" /gene_synonym="Par-4; PAR4" /replace="c" /replace="t" /db_xref="dbSNP:8176804" variation 519 /gene="PAWR" /gene_synonym="Par-4; PAR4" /replace="c" /replace="g" /db_xref="dbSNP:8176805" variation 696 /gene="PAWR" /gene_synonym="Par-4; PAR4" /replace="c" /replace="g" /db_xref="dbSNP:8176806" exon 803..934 /gene="PAWR" /gene_synonym="Par-4; PAR4" /inference="alignment:Splign:1.39.8" variation 883 /gene="PAWR" /gene_synonym="Par-4; PAR4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:2307223" variation 891 /gene="PAWR" /gene_synonym="Par-4; PAR4" /replace="a" /replace="c" /db_xref="dbSNP:8176870" exon 935..969 /gene="PAWR" /gene_synonym="Par-4; PAR4" /inference="alignment:Splign:1.39.8" exon 970..1117 /gene="PAWR" /gene_synonym="Par-4; PAR4" /inference="alignment:Splign:1.39.8" exon 1118..1222 /gene="PAWR" /gene_synonym="Par-4; PAR4" /inference="alignment:Splign:1.39.8" exon 1223..1951 /gene="PAWR" /gene_synonym="Par-4; PAR4" /inference="alignment:Splign:1.39.8" variation 1291 /gene="PAWR" /gene_synonym="Par-4; PAR4" /replace="g" /replace="t" /db_xref="dbSNP:8176908" variation 1547 /gene="PAWR" /gene_synonym="Par-4; PAR4" /replace="g" /replace="t" /db_xref="dbSNP:8176909" variation 1822 /gene="PAWR" /gene_synonym="Par-4; PAR4" /replace="g" /replace="t" /db_xref="dbSNP:2307220" polyA_signal 1924..1929 /gene="PAWR" /gene_synonym="Par-4; PAR4" polyA_site 1951 /gene="PAWR" /gene_synonym="Par-4; PAR4" ORIGIN
ctgtcctgggattgcctggagctccgcaccgcgagtttgccgcggcactttccgcgcggcggaagagcgcgcgccagcttcggcacacctgggagccggatcccagccctacgcctcgtcccctacaagctcctccaagccccgccggctgctgtgggagcggcggccgtccctctcctggaggtcgtctcctggcatcctcggggccgcaggaaggaagaggaggcagcggccggagccctggtgggcggcctgaggtgagagcccgaccggcccctttgggaatatggcgaccggtggctaccggaccagcagcggcctcggcggcagcaccacagacttcctggaggagtggaaggcgaaacgcgagaagatgcgcgccaagcagaaccccccgggcccggcccccccgggagggggcagcagcgacgccgctgggaagccccccgcgggggctctgggcaccccggcggccgccgctgccaacgagctcaacaacaacctcccgggcggcgcgccggccgcacctgccgtccccggtcccgggggcgtgaactgcgcggtcggctccgccatgctgacgcgggcggcccccggcccgcggcggtcggaggacgagcccccagccgcctctgcctcggctgcaccgccgccccagcgtgacgaggaggagccggacggcgtcccagagaagggcaagagctcgggccccagtgccaggaaaggcaaggggcagatcgagaagaggaagctgcgggagaagcggcgctccaccggcgtggtcaacatccctgccgcagagtgcttagatgagtacgaagatgatgaagcagggcagaaagagcggaaacgagaagatgcaattacacaacagaacactattcagaatgaagctgtaaacttactagatccaggcagttcctatctgctacaggagccacctagaacagtttcaggcagatataaaagcacaaccagtgtctctgaagaagatgtctcaagtagatattctcgaacagatagaagtgggttccctagatataacagggatgcaaatgtttcaggtactctggtttcaagtagcacactggaaaagaaaattgaagatcttgaaaaggaagtagtaagagaaagacaagaaaacctaagacttgtgagactgatgcaagataaagaggaaatgattggaaaactcaaagaagaaattgatttattaaatagagacctagatgacatagaagatgaaaatgaacagctaaagcaggaaaataaaactcttttgaaagttgtgggtcagctgaccaggtagaggattcaagactcaatgtggaaaaaatattttaaactactgattgaatgttaatggtcaatgctagcacaatattcctatgctgcaatacattaaaataactaagcaagtatatttatttctagcaaacagatgtttgttttcaaaatacttctttttcattattggttttaaaaaagcattatccttttatctcacaaataagtaatatctttcagttattaaatgatagataatgcctttttggttttgtgtggtattcaactaatacatggtttaaagtcacagccgtttgaatatattttatcttggtagtacattttctcccttaggaatatacatagtctttgtttacatgagttcaaatacttttgggatgttaccttcacatgtcctattactgatgtgtgcaaccttttatgtgttgatgactcactcataaaggtttttgtctactgtcatttgttctttccacttattctaagcatttagagtaatagagtcatacttttttataacagcaaccttttaaaaggaaagctcttataaagtcactgtcatgttttagttgactaaatataaatttaagagaatacttgaattgtgctatagtaaataaaaatttactattttgtgtttgaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:5074 -> Molecular function: GO:0003714 [transcription corepressor activity] evidence: TAS GeneID:5074 -> Molecular function: GO:0003779 [actin binding] evidence: ISS GeneID:5074 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:5074 -> Molecular function: GO:0019899 [enzyme binding] evidence: IDA GeneID:5074 -> Molecular function: GO:0043522 [leucine zipper domain binding] evidence: IPI GeneID:5074 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: TAS GeneID:5074 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA GeneID:5074 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:5074 -> Biological process: GO:0006917 [induction of apoptosis] evidence: ISS GeneID:5074 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: TAS GeneID:5074 -> Biological process: GO:0030889 [negative regulation of B cell proliferation] evidence: IEA GeneID:5074 -> Biological process: GO:0042094 [interleukin-2 biosynthetic process] evidence: IEA GeneID:5074 -> Biological process: GO:0042130 [negative regulation of T cell proliferation] evidence: IEA GeneID:5074 -> Biological process: GO:0042986 [positive regulation of amyloid precursor protein biosynthetic process] evidence: IEA GeneID:5074 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: NAS GeneID:5074 -> Biological process: GO:0050860 [negative regulation of T cell receptor signaling pathway] evidence: IEA GeneID:5074 -> Biological process: GO:0051017 [actin filament bundle assembly] evidence: ISS GeneID:5074 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:5074 -> Cellular component: GO:0005634 [nucleus] evidence: NAS GeneID:5074 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA GeneID:5074 -> Cellular component: GO:0005737 [cytoplasm] evidence: NAS GeneID:5074 -> Cellular component: GO:0005884 [actin filament] evidence: ISS GeneID:5074 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.