Home |
Help |
Advanced search
2024-04-20 12:38:42, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002576 3435 bp mRNA linear PRI 01-JUL-2013
DEFINITION Homo sapiens p21 protein (Cdc42/Rac)-activated kinase 1 (PAK1),
transcript variant 2, mRNA.
ACCESSION NM_002576
VERSION NM_002576.4 GI:190886455
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3435)
AUTHORS Ong,C.C., Jubb,A.M., Jakubiak,D., Zhou,W., Rudolph,J.,
Haverty,P.M., Kowanetz,M., Yan,Y., Tremayne,J., Lisle,R.,
Harris,A.L., Friedman,L.S., Belvin,M., Middleton,M.R.,
Blackwood,E.M., Koeppen,H. and Hoeflich,K.P.
TITLE P21-activated kinase 1 (PAK1) as a therapeutic target in BRAF
wild-type melanoma
JOURNAL J. Natl. Cancer Inst. 105 (9), 606-607 (2013)
PUBMED 23535073
REMARK GeneRIF: Taken together, our results provide evidence for a
functional role of PAK1 in BRAF wild-type melanoma and therapeutic
use of PAK inhibitors in this indication.
REFERENCE 2 (bases 1 to 3435)
AUTHORS Malecka,K.A., Szentpetery,Z. and Peterson,J.R.
TITLE Synergistic activation of p21-activated kinase 1 by
phosphatidylinositol 4,5-bisphosphate and Rho GTPases
JOURNAL J. Biol. Chem. 288 (13), 8887-8897 (2013)
PUBMED 23393142
REMARK GeneRIF: analysis of synergistic activation of p21-activated kinase
1 by phosphatidylinositol 4,5-bisphosphate and Rho GTPases
REFERENCE 3 (bases 1 to 3435)
AUTHORS Kalwat,M.A., Yoder,S.M., Wang,Z. and Thurmond,D.C.
TITLE A p21-activated kinase (PAK1) signaling cascade coordinately
regulates F-actin remodeling and insulin granule exocytosis in
pancreatic beta cells
JOURNAL Biochem. Pharmacol. 85 (6), 808-816 (2013)
PUBMED 23246867
REMARK GeneRIF: data suggest that glucose-mediated activation of Cdc42
leads to activation of PAK1 and prompts activation of its
downstream targets Raf-1, MEK1/2 and ERK1/2 to elicit F-actin
remodeling and recruitment of insulin granules to the plasma
membrane
REFERENCE 4 (bases 1 to 3435)
AUTHORS Goc,A., Al-Azayzih,A., Abdalla,M., Al-Husein,B., Kavuri,S., Lee,J.,
Moses,K. and Somanath,P.R.
TITLE P21 activated kinase-1 (Pak1) promotes prostate tumor growth and
microinvasion via inhibition of transforming growth factor beta
expression and enhanced matrix metalloproteinase 9 secretion
JOURNAL J. Biol. Chem. 288 (5), 3025-3035 (2013)
PUBMED 23258534
REMARK GeneRIF: Gene array data revealed reduced expression of matrix
metalloproteinase 9 with the ablation of either Pak1 or Pak6 gene
expression in PC3 cells.
REFERENCE 5 (bases 1 to 3435)
AUTHORS Pakala,S.B., Nair,V.S., Reddy,S.D. and Kumar,R.
TITLE Signaling-dependent phosphorylation of mitotic
centromere-associated kinesin regulates microtubule
depolymerization and its centrosomal localization
JOURNAL J. Biol. Chem. 287 (48), 40560-40569 (2012)
PUBMED 23055517
REMARK GeneRIF: PAK1 phosphorylates MCAK and regulates both its
localization and function.
REFERENCE 6 (bases 1 to 3435)
AUTHORS Manser,E., Huang,H.Y., Loo,T.H., Chen,X.Q., Dong,J.M., Leung,T. and
Lim,L.
TITLE Expression of constitutively active alpha-PAK reveals effects of
the kinase on actin and focal complexes
JOURNAL Mol. Cell. Biol. 17 (3), 1129-1143 (1997)
PUBMED 9032240
REFERENCE 7 (bases 1 to 3435)
AUTHORS Bokoch,G.M., Wang,Y., Bohl,B.P., Sells,M.A., Quilliam,L.A. and
Knaus,U.G.
TITLE Interaction of the Nck adapter protein with p21-activated kinase
(PAK1)
JOURNAL J. Biol. Chem. 271 (42), 25746-25749 (1996)
PUBMED 8824201
REFERENCE 8 (bases 1 to 3435)
AUTHORS Brown,J.L., Stowers,L., Baer,M., Trejo,J., Coughlin,S. and Chant,J.
TITLE Human Ste20 homologue hPAK1 links GTPases to the JNK MAP kinase
pathway
JOURNAL Curr. Biol. 6 (5), 598-605 (1996)
PUBMED 8805275
REFERENCE 9 (bases 1 to 3435)
AUTHORS Martin,G.A., Bollag,G., McCormick,F. and Abo,A.
TITLE A novel serine kinase activated by rac1/CDC42Hs-dependent
autophosphorylation is related to PAK65 and STE20
JOURNAL EMBO J. 14 (9), 1970-1978 (1995)
PUBMED 7744004
REMARK Erratum:[EMBO J. 1995 Sep 1;14(17):4385. PMID: 7556080]
REFERENCE 10 (bases 1 to 3435)
AUTHORS Manser,E., Leung,T., Salihuddin,H., Zhao,Z.S. and Lim,L.
TITLE A brain serine/threonine protein kinase activated by Cdc42 and Rac1
JOURNAL Nature 367 (6458), 40-46 (1994)
PUBMED 8107774
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DA393732.1, BC109299.1,
BC050377.1 and BI793123.1.
On Jun 20, 2008 this sequence version replaced gi:42794768.
Summary: This gene encodes a family member of serine/threonine
p21-activating kinases, known as PAK proteins. These proteins are
critical effectors that link RhoGTPases to cytoskeleton
reorganization and nuclear signaling, and they serve as targets for
the small GTP binding proteins Cdc42 and Rac. This specific family
member regulates cell motility and morphology. Alternatively
spliced transcript variants encoding different isoforms have been
found for this gene. [provided by RefSeq, Apr 2010].
Transcript Variant: This variant (2) lacks a coding exon in the 3'
region, as compared to variant 1. The resulting isoform (2) has a
shorter and distinct C-terminus compared to isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC050377.1, U24152.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-392 DA393732.1 1-392
393-2885 BC109299.1 1-2493
2886-3048 BC050377.1 2478-2640
3049-3435 BI793123.1 57-443
FEATURES Location/Qualifiers
source 1..3435
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="11"
/map="11q13-q14"
gene 1..3435
/gene="PAK1"
/gene_synonym="PAKalpha"
/note="p21 protein (Cdc42/Rac)-activated kinase 1"
/db_xref="GeneID:5058"
/db_xref="HGNC:8590"
/db_xref="HPRD:03995"
/db_xref="MIM:602590"
exon 1..512
/gene="PAK1"
/gene_synonym="PAKalpha"
/inference="alignment:Splign:1.39.8"
exon 513..723
/gene="PAK1"
/gene_synonym="PAKalpha"
/inference="alignment:Splign:1.39.8"
misc_feature 513..515
/gene="PAK1"
/gene_synonym="PAKalpha"
/note="upstream in-frame stop codon"
CDS 534..2171
/gene="PAK1"
/gene_synonym="PAKalpha"
/EC_number="2.7.11.1"
/note="isoform 2 is encoded by transcript variant 2;
p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related);
p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast);
serine/threonine-protein kinase PAK 1; p65-PAK; alpha-PAK"
/codon_start=1
/product="serine/threonine-protein kinase PAK 1 isoform 2"
/protein_id="NP_002567.3"
/db_xref="GI:42794769"
/db_xref="CCDS:CCDS8250.1"
/db_xref="GeneID:5058"
/db_xref="HGNC:8590"
/db_xref="HPRD:03995"
/db_xref="MIM:602590"
/translation="
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH
"
misc_feature 594..596
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by PKB and autocatalysis; propagated
from UniProtKB/Swiss-Prot (Q13153.2); phosphorylation
site"
misc_feature 594..596
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[6]
/db_xref="HPRD:03995"
misc_feature 702..704
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by autocatalysis; propagated from
UniProtKB/Swiss-Prot (Q13153.2); phosphorylation site"
misc_feature 702..704
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[6]
/db_xref="HPRD:03995"
misc_feature 741..953
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q13153.2);
Region: Autoregulatory region"
misc_feature 750..887
/gene="PAK1"
/gene_synonym="PAKalpha"
/note="PAK (p21 activated kinase) Binding Domain (PBD),
binds Cdc42p- and/or Rho-like small GTPases; also known as
the Cdc42/Rac interactive binding (CRIB) motif; has been
shown to inhibit transcriptional activation and cell
transformation mediated by the...; Region: CRIB_PAK_like;
cd01093"
/db_xref="CDD:29038"
misc_feature order(756..758,765..767,774..776,780..782,789..791,
840..842,852..854)
/gene="PAK1"
/gene_synonym="PAKalpha"
/note="GTPase interaction site [polypeptide binding];
other site"
/db_xref="CDD:29038"
misc_feature 756..848
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q13153.2);
Region: GTPase-binding"
misc_feature 783..785
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:06809"
misc_feature 924..926
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphotyrosine; propagated from
UniProtKB/Swiss-Prot (Q13153.2); phosphorylation site"
misc_feature 927..1343
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q13153.2);
Region: Interaction with CRIPAK"
misc_feature 957..959
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphotyrosine; propagated from
UniProtKB/Swiss-Prot (Q13153.2); phosphorylation site"
misc_feature 963..965
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q13153.2); phosphorylation site"
misc_feature 963..965
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[6]
/db_xref="HPRD:03995"
misc_feature 978..980
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q13153.2); phosphorylation site"
misc_feature 978..980
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[6]
/db_xref="HPRD:03995"
misc_feature 990..992
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphotyrosine, by JAK2; propagated from
UniProtKB/Swiss-Prot (Q13153.2); phosphorylation site"
misc_feature 1026..1028
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03995"
misc_feature 1053..1055
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q13153.2); phosphorylation site"
misc_feature 1086..1088
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine; propagated from
UniProtKB/Swiss-Prot (Q13153.2); phosphorylation site"
misc_feature 1128..1130
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[6]
/db_xref="HPRD:03995"
misc_feature 1134..1136
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphotyrosine, by JAK2; propagated from
UniProtKB/Swiss-Prot (Q13153.2); phosphorylation site"
misc_feature 1143..1145
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q13153.2); phosphorylation site"
misc_feature 1143..1145
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[6]
/db_xref="HPRD:03995"
misc_feature 1167..1169
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine; propagated from
UniProtKB/Swiss-Prot (Q13153.2); phosphorylation site"
misc_feature 1167..1169
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:00449"
misc_feature 1188..1190
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine; propagated from
UniProtKB/Swiss-Prot (Q13153.2); phosphorylation site"
misc_feature 1191..1193
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q13153.2); phosphorylation site"
misc_feature 1191..1193
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 1200..1202
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q13153.2); phosphorylation site"
misc_feature 1200..1202
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 1221..1223
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine; propagated from
UniProtKB/Swiss-Prot (Q13153.2); phosphorylation site"
misc_feature 1281..2159
/gene="PAK1"
/gene_synonym="PAKalpha"
/note="Catalytic domain of the Protein Serine/Threonine
Kinase, Group I p21-activated kinase; Region: STKc_PAK_I;
cd06647"
/db_xref="CDD:132978"
misc_feature 1341..2096
/gene="PAK1"
/gene_synonym="PAKalpha"
/note="Serine/Threonine protein kinases, catalytic domain;
Region: S_TKc; smart00220"
/db_xref="CDD:197582"
misc_feature order(1359..1373,1383..1385,1422..1424,1428..1430,
1515..1517,1563..1577,1581..1586,1593..1595,1698..1700,
1704..1715,1719..1721,1749..1754,1761..1763,1800..1814,
1818..1820,1899..1901,1926..1934)
/gene="PAK1"
/gene_synonym="PAKalpha"
/note="active site"
/db_xref="CDD:132978"
misc_feature order(1359..1373,1383..1385,1422..1424,1428..1430,
1515..1517,1563..1577,1581..1586,1593..1595,1710..1715,
1719..1721,1749..1754)
/gene="PAK1"
/gene_synonym="PAKalpha"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:132978"
misc_feature order(1368..1373,1698..1700,1704..1712,1761..1763,
1800..1814,1818..1820,1899..1901,1926..1934)
/gene="PAK1"
/gene_synonym="PAKalpha"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:132978"
misc_feature order(1374..1376,1476..1478,1683..1685,1689..1700,
1752..1757,1836..1841,1845..1847,1860..1862,1935..1937,
1944..1946,1953..1955)
/gene="PAK1"
/gene_synonym="PAKalpha"
/note="autoinhibitory domain (AID) interaction site; other
site"
/db_xref="CDD:132978"
misc_feature 1386..1388
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphotyrosine, by JAK2; propagated from
UniProtKB/Swiss-Prot (Q13153.2); phosphorylation site"
misc_feature 1749..1820
/gene="PAK1"
/gene_synonym="PAKalpha"
/note="activation loop (A-loop); other site"
/db_xref="CDD:132978"
misc_feature 1800..1802
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine, by autocatalysis, BRSK2 and
PDPK1; propagated from UniProtKB/Swiss-Prot (Q13153.2);
phosphorylation site"
misc_feature 1800..1802
/gene="PAK1"
/gene_synonym="PAKalpha"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:05556"
variation 610
/gene="PAK1"
/gene_synonym="PAKalpha"
/replace="c"
/replace="t"
/db_xref="dbSNP:1048521"
exon 724..824
/gene="PAK1"
/gene_synonym="PAKalpha"
/inference="alignment:Splign:1.39.8"
variation 824
/gene="PAK1"
/gene_synonym="PAKalpha"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1130059"
exon 825..972
/gene="PAK1"
/gene_synonym="PAKalpha"
/inference="alignment:Splign:1.39.8"
exon 973..1010
/gene="PAK1"
/gene_synonym="PAKalpha"
/inference="alignment:Splign:1.39.8"
exon 1011..1130
/gene="PAK1"
/gene_synonym="PAKalpha"
/inference="alignment:Splign:1.39.8"
STS 1091..2109
/gene="PAK1"
/gene_synonym="PAKalpha"
/standard_name="Pak1"
/db_xref="UniSTS:527474"
variation 1092
/gene="PAK1"
/gene_synonym="PAKalpha"
/replace="a"
/replace="c"
/db_xref="dbSNP:1140258"
exon 1131..1305
/gene="PAK1"
/gene_synonym="PAKalpha"
/inference="alignment:Splign:1.39.8"
STS 1171..1250
/gene="PAK1"
/gene_synonym="PAKalpha"
/standard_name="PMC140666P2"
/db_xref="UniSTS:270955"
variation 1243
/gene="PAK1"
/gene_synonym="PAKalpha"
/replace="g"
/replace="t"
/db_xref="dbSNP:1048522"
variation 1244
/gene="PAK1"
/gene_synonym="PAKalpha"
/replace="g"
/replace="t"
/db_xref="dbSNP:1048523"
exon 1306..1369
/gene="PAK1"
/gene_synonym="PAKalpha"
/inference="alignment:Splign:1.39.8"
exon 1370..1418
/gene="PAK1"
/gene_synonym="PAKalpha"
/inference="alignment:Splign:1.39.8"
exon 1419..1531
/gene="PAK1"
/gene_synonym="PAKalpha"
/inference="alignment:Splign:1.39.8"
exon 1532..1649
/gene="PAK1"
/gene_synonym="PAKalpha"
/inference="alignment:Splign:1.39.8"
exon 1650..1749
/gene="PAK1"
/gene_synonym="PAKalpha"
/inference="alignment:Splign:1.39.8"
exon 1750..1946
/gene="PAK1"
/gene_synonym="PAKalpha"
/inference="alignment:Splign:1.39.8"
exon 1947..2084
/gene="PAK1"
/gene_synonym="PAKalpha"
/inference="alignment:Splign:1.39.8"
STS 2080..2286
/gene="PAK1"
/gene_synonym="PAKalpha"
/standard_name="AI072234"
/db_xref="UniSTS:244921"
exon 2085..3430
/gene="PAK1"
/gene_synonym="PAKalpha"
/inference="alignment:Splign:1.39.8"
STS 2214..2438
/gene="PAK1"
/gene_synonym="PAKalpha"
/standard_name="SHGC-35393"
/db_xref="UniSTS:45214"
variation 2782
/gene="PAK1"
/gene_synonym="PAKalpha"
/replace="g"
/replace="t"
/db_xref="dbSNP:2844337"
variation 2791
/gene="PAK1"
/gene_synonym="PAKalpha"
/replace="c"
/replace="t"
/db_xref="dbSNP:2729762"
STS 2984..3168
/gene="PAK1"
/gene_synonym="PAKalpha"
/standard_name="RH94191"
/db_xref="UniSTS:90573"
STS 3230..3363
/gene="PAK1"
/gene_synonym="PAKalpha"
/standard_name="D11S4697"
/db_xref="UniSTS:44363"
polyA_signal 3406..3411
/gene="PAK1"
/gene_synonym="PAKalpha"
polyA_site 3430
/gene="PAK1"
/gene_synonym="PAKalpha"
ORIGIN
tgccctcccgcggctgcagccggagccgaaggtggtggctgcacagtagacgccccctcacggcttcccccacacgctcccgccccctcgctcgcccatcgcgcttccctcacaggctctgcagtcctcccccacagacgccttcccccttggactctcattcccttttccacggagccccgcgctttcgtgagccccctcgaggaacctggtctccgcatccagttaccacctcctgcctcagaggccatctgagcccttcgcacctcgcccctcagtccccccttccccccccgcccgcgtcgcctcgctccctcccgcccccccatcatcccttccctcgcagttcccctgtcctgaggggagccccgccacgggcagcgcggcggcggcggcaggagggagaaagtgaagcggtagctcgcgcacactcgcgccctcactcccggctaggcggcacccaccgccgggaggaggaggaggagccgagaggagctgagcgagcgcggaagtagctgctgctggtggtgacaatgtcaaataacggcctagacattcaagacaaacccccagcccctccgatgagaaataccagcactatgattggagccggcagcaaagatgctggaaccctaaaccatggttctaaacctctgcctccaaacccagaggagaagaaaaagaaggaccgattttaccgatccattttacctggagataaaacaaataaaaagaaagagaaagagcggccagagatttctctcccttcagattttgaacacacaattcatgtcggttttgatgctgtcacaggggagtttacgggaatgccagagcagtgggcccgcttgcttcagacatcaaatatcactaagtcggagcagaagaaaaacccgcaggctgttctggatgtgttggagttttacaactcgaagaagacatccaacagccagaaatacatgagctttacagataagtcagctgaggattacaattcttctaatgccttgaatgtgaaggctgtgtctgagactcctgcagtgccaccagtttcagaagatgaggatgatgatgatgatgatgctaccccaccaccagtgattgctccacgcccagagcacacaaaatctgtatacacacggtctgtgattgaaccacttcctgtcactccaactcgggacgtggctacatctcccatttcacctactgaaaataacaccactccaccagatgctttgacccggaatactgagaagcagaagaagaagcctaaaatgtctgatgaggagatcttggagaaattacgaagcatagtgagtgtgggcgatcctaagaagaaatatacacggtttgagaagattggacaaggtgcttcaggcaccgtgtacacagcaatggatgtggccacaggacaggaggtggccattaagcagatgaatcttcagcagcagcccaagaaagagctgattattaatgagatcctggtcatgagggaaaacaagaacccaaacattgtgaattacttggacagttacctcgtgggagatgagctgtgggttgttatggaatacttggctggaggctccttgacagatgtggtgacagaaacttgcatggatgaaggccaaattgcagctgtgtgccgtgagtgtctgcaggctctggagttcttgcattcgaaccaggtcattcacagagacatcaagagtgacaatattctgttgggaatggatggctctgtcaagctaactgactttggattctgtgcacagataaccccagagcagagcaaacggagcaccatggtaggaaccccatactggatggcaccagaggttgtgacacgaaaggcctatgggcccaaggttgacatctggtccctgggcatcatggccatcgaaatgattgaaggggagcctccatacctcaatgaaaaccctctgagagccttgtacctcattgccaccaatgggaccccagaacttcagaacccagagaagctgtcagctatcttccgggactttctgaaccgctgtctcgagatggatgtggagaagagaggttcagctaaagagctgctacagcatcaattcctgaagattgccaagcccctctccagcctcactccactgattgctgcagctaaggaggcaacaaagaacaatcactaaaaccacactcaccccagcctcattgtgccaagccttctgtgagataaatgcacatttcagaaattccaactcctgatgccctcttctccttgccttgcttctcccatttcctgatctagcactcctcaagactttgatccttggaaaccgtgtgtccagcattgaagagaactgcaactgaatgactaatcagatgatggccatttctaaataaggaatttcctcccaattcatggatatgagggtggtttatgattaagggtttatataaataaatgtttctagtcttccgtgtgtcaaaatcctcacctccttcataaccatctcccacaattaattcttgactatataaatttatggtttgataatattatcaatttgtaatcaattgagatttctttagtgcttgcttttctgtgactcaactgcccagacacctcattgtacttgaaaactggaacagcttgggaatgccatggggtttgataatctgccagggacatgaagaggctcagcttcctggaccatgactttggctcagctgatcctgacatgggagaacaaccacatttttctttgtgtgtgcttctagcagctgttcgggaggaccttgacccaatagtgttcccatgctgtttcttgtgaaatgctctcggctatgtagcagcttttgattccctgcataccctaggctgctgcccctatcctgtcccttgtttataacattgagaggttttctagggcacatactgagtgagagcagtgttgagaagtcggggaaaatggtgactacttttagagcaaggctgggcatcagcacctgtccagctctacttgtgtgatgtttcaggaactcagcccctttttctgcctaggataaggagctgaaagattaacttggatcttctaatggtccaaatcttttggtcacaataaagagtctccaaattagagactgcatgttagttctggatggatttggtggcctgacatgataccctgccagctgtgaggggaccccgtttttaagatgcatggccaagctctctgcaaatggaaatgcttacactgggtgttggggatgtttgctacctcctgctatttttgtggttttggttctcccactatggtaggacccctggccagcattgtggcttgtcatgtcagccccattgactaccttctcatgctctgaggtactactgcctctgcagcacaaatttctatttctgtcaataaaaggagatgaaaatattctaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:5058 -> Molecular function: GO:0004672 [protein kinase activity] evidence: IDA
GeneID:5058 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IDA
GeneID:5058 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: TAS
GeneID:5058 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:5058 -> Molecular function: GO:0005518 [collagen binding] evidence: IPI
GeneID:5058 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA
GeneID:5058 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IEA
GeneID:5058 -> Molecular function: GO:0042802 [identical protein binding] evidence: IPI
GeneID:5058 -> Biological process: GO:0000165 [MAPK cascade] evidence: IDA
GeneID:5058 -> Biological process: GO:0001666 [response to hypoxia] evidence: IEA
GeneID:5058 -> Biological process: GO:0006468 [protein phosphorylation] evidence: IDA
GeneID:5058 -> Biological process: GO:0006887 [exocytosis] evidence: IEA
GeneID:5058 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:5058 -> Biological process: GO:0007411 [axon guidance] evidence: TAS
GeneID:5058 -> Biological process: GO:0007528 [neuromuscular junction development] evidence: IEA
GeneID:5058 -> Biological process: GO:0016358 [dendrite development] evidence: IEA
GeneID:5058 -> Biological process: GO:0031295 [T cell costimulation] evidence: TAS
GeneID:5058 -> Biological process: GO:0031532 [actin cytoskeleton reorganization] evidence: IDA
GeneID:5058 -> Biological process: GO:0031532 [actin cytoskeleton reorganization] evidence: IMP
GeneID:5058 -> Biological process: GO:0032869 [cellular response to insulin stimulus] evidence: IEA
GeneID:5058 -> Biological process: GO:0033138 [positive regulation of peptidyl-serine phosphorylation] evidence: IDA
GeneID:5058 -> Biological process: GO:0033148 [positive regulation of intracellular estrogen receptor signaling pathway] evidence: IDA
GeneID:5058 -> Biological process: GO:0033554 [cellular response to stress] evidence: IEA
GeneID:5058 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS
GeneID:5058 -> Biological process: GO:0038096 [Fc-gamma receptor signaling pathway involved in phagocytosis] evidence: TAS
GeneID:5058 -> Biological process: GO:0042060 [wound healing] evidence: IMP
GeneID:5058 -> Biological process: GO:0043113 [receptor clustering] evidence: IEA
GeneID:5058 -> Biological process: GO:0043507 [positive regulation of JUN kinase activity] evidence: IMP
GeneID:5058 -> Biological process: GO:0045087 [innate immune response] evidence: TAS
GeneID:5058 -> Biological process: GO:0046777 [protein autophosphorylation] evidence: IDA
GeneID:5058 -> Biological process: GO:0048754 [branching morphogenesis of an epithelial tube] evidence: IMP
GeneID:5058 -> Biological process: GO:0048812 [neuron projection morphogenesis] evidence: ISS
GeneID:5058 -> Biological process: GO:0050852 [T cell receptor signaling pathway] evidence: TAS
GeneID:5058 -> Biological process: GO:0051496 [positive regulation of stress fiber assembly] evidence: IMP
GeneID:5058 -> Biological process: GO:0060244 [negative regulation of cell proliferation involved in contact inhibition] evidence: IMP
GeneID:5058 -> Cellular component: GO:0001726 [ruffle] evidence: IDA
GeneID:5058 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:5058 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: IDA
GeneID:5058 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:5058 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA
GeneID:5058 -> Cellular component: GO:0005911 [cell-cell junction] evidence: IDA
GeneID:5058 -> Cellular component: GO:0005925 [focal adhesion] evidence: IEA
GeneID:5058 -> Cellular component: GO:0014704 [intercalated disc] evidence: ISS
GeneID:5058 -> Cellular component: GO:0030018 [Z disc] evidence: ISS
GeneID:5058 -> Cellular component: GO:0030424 [axon] evidence: ISS
GeneID:5058 -> Cellular component: GO:0030425 [dendrite] evidence: ISS
GeneID:5058 -> Cellular component: GO:0030426 [growth cone] evidence: IEA
GeneID:5058 -> Cellular component: GO:0031941 [filamentous actin] evidence: NAS
GeneID:5058 -> Cellular component: GO:0031965 [nuclear membrane] evidence: ISS
GeneID:5058 -> Cellular component: GO:0043234 [protein complex] evidence: IDA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_002567 -> EC 2.7.11.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.