Home |
Help |
Advanced search
2024-04-20 14:54:31, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002546 2354 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens tumor necrosis factor receptor superfamily, member 11b
(TNFRSF11B), mRNA.
ACCESSION NM_002546
VERSION NM_002546.3 GI:148743792
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2354)
AUTHORS Cody,J.J., Rivera,A.A., Lyons,G.R., Yang,S.W., Wang,M.,
Ashley,J.W., Meleth,S., Feng,X., Siegal,G.P. and Douglas,J.T.
TITLE Expression of osteoprotegerin from a replicating adenovirus
inhibits the progression of prostate cancer bone metastases in a
murine model
JOURNAL Lab. Invest. 93 (3), 268-278 (2013)
PUBMED 23358109
REMARK GeneRIF: Expression of osteoprotegerin from a replicating
adenovirus inhibits the progression of prostate cancer bone
metastases in a murine model.
REFERENCE 2 (bases 1 to 2354)
AUTHORS Hartwich,J.E., Orr,W.S., Ng,C.Y., Spence,Y., McLaughlin,J.M.,
Furman,W.L., McGregor,L.M. and Davidoff,A.M.
TITLE Rapamycin increases neuroblastoma xenograft and host stromal
derived osteoprotegerin inhibiting osteolytic bone disease in a
bone metastasis model
JOURNAL J. Pediatr. Surg. 48 (1), 47-55 (2013)
PUBMED 23331792
REMARK GeneRIF: In a xenograft model, increased osteoprotegerin expression
correlated with a delay to pathologic fracture suggesting a
potential role for mTOR inhibitors in the treatment of
neuroblastoma bone metastases.
REFERENCE 3 (bases 1 to 2354)
AUTHORS Paternoster,L., Lorentzon,M., Lehtimaki,T., Eriksson,J.,
Kahonen,M., Raitakari,O., Laaksonen,M., Sievanen,H., Viikari,J.,
Lyytikainen,L.P., Mellstrom,D., Karlsson,M., Ljunggren,O.,
Grundberg,E., Kemp,J.P., Sayers,A., Nethander,M., Evans,D.M.,
Vandenput,L., Tobias,J.H. and Ohlsson,C.
TITLE Genetic determinants of trabecular and cortical volumetric bone
mineral densities and bone microstructure
JOURNAL PLoS Genet. 9 (2), E1003247 (2013)
PUBMED 23437003
REFERENCE 4 (bases 1 to 2354)
AUTHORS Ney,J.T., Juhasz-Boess,I., Gruenhage,F., Graeber,S., Bohle,R.M.,
Pfreundschuh,M., Solomayer,E.F. and Assmann,G.
TITLE Genetic polymorphism of the OPG gene associated with breast cancer
JOURNAL BMC Cancer 13, 40 (2013)
PUBMED 23369128
REMARK GeneRIF: Report a significant association of OPG SNP rs3102735 with
the susceptibility to develop breast cancer in the Caucasian
population.
Publication Status: Online-Only
REFERENCE 5 (bases 1 to 2354)
AUTHORS Kadkhodazadeh,M., Tabari,Z.A., Ardakani,M.R., Ebadian,A.R. and
Brook,A.
TITLE Analysis of osteoprotegerin (OPG) gene polymorphism in Iranian
patients with chronic periodontitis and peri-implantitis. A
cross-sectional study
JOURNAL Eur J Oral Implantol 5 (4), 381-388 (2012)
PUBMED 23304691
REMARK GeneRIF: a single nucleotide polymorphism at G1181C is associated
with the presence of peri-implantitis
REFERENCE 6 (bases 1 to 2354)
AUTHORS Tomoyasu,A., Goto,M., Fujise,N., Mochizuki,S., Yasuda,H.,
Morinaga,T., Tsuda,E. and Higashio,K.
TITLE Characterization of monomeric and homodimeric forms of
osteoclastogenesis inhibitory factor
JOURNAL Biochem. Biophys. Res. Commun. 245 (2), 382-387 (1998)
PUBMED 9571159
REFERENCE 7 (bases 1 to 2354)
AUTHORS Yamaguchi,K., Kinosaki,M., Goto,M., Kobayashi,F., Tsuda,E.,
Morinaga,T. and Higashio,K.
TITLE Characterization of structural domains of human osteoclastogenesis
inhibitory factor
JOURNAL J. Biol. Chem. 273 (9), 5117-5123 (1998)
PUBMED 9478964
REFERENCE 8 (bases 1 to 2354)
AUTHORS Tan,K.B., Harrop,J., Reddy,M., Young,P., Terrett,J., Emery,J.,
Moore,G. and Truneh,A.
TITLE Characterization of a novel TNF-like ligand and recently described
TNF ligand and TNF receptor superfamily genes and their
constitutive and inducible expression in hematopoietic and
non-hematopoietic cells
JOURNAL Gene 204 (1-2), 35-46 (1997)
PUBMED 9434163
REFERENCE 9 (bases 1 to 2354)
AUTHORS Tsuda,E., Goto,M., Mochizuki,S., Yano,K., Kobayashi,F., Morinaga,T.
and Higashio,K.
TITLE Isolation of a novel cytokine from human fibroblasts that
specifically inhibits osteoclastogenesis
JOURNAL Biochem. Biophys. Res. Commun. 234 (1), 137-142 (1997)
PUBMED 9168977
REFERENCE 10 (bases 1 to 2354)
AUTHORS Simonet,W.S., Lacey,D.L., Dunstan,C.R., Kelley,M., Chang,M.S.,
Luthy,R., Nguyen,H.Q., Wooden,S., Bennett,L., Boone,T.,
Shimamoto,G., DeRose,M., Elliott,R., Colombero,A., Tan,H.L.,
Trail,G., Sullivan,J., Davy,E., Bucay,N., Renshaw-Gegg,L.,
Hughes,T.M., Hill,D., Pattison,W., Campbell,P., Sander,S., Van,G.,
Tarpley,J., Derby,P., Lee,R. and Boyle,W.J.
TITLE Osteoprotegerin: a novel secreted protein involved in the
regulation of bone density
JOURNAL Cell 89 (2), 309-319 (1997)
PUBMED 9108485
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DA477521.1, AK223155.1 and
CK903484.1.
This sequence is a reference standard in the RefSeqGene project.
On Jun 8, 2007 this sequence version replaced gi:22547122.
Summary: The protein encoded by this gene is a member of the
TNF-receptor superfamily. This protein is an osteoblast-secreted
decoy receptor that functions as a negative regulator of bone
resorption. This protein specifically binds to its ligand,
osteoprotegerin ligand, both of which are key extracellular
regulators of osteoclast development. Studies of the mouse
counterpart also suggest that this protein and its ligand play a
role in lymph-node organogenesis and vascular calcification.
Alternatively spliced transcript variants of this gene have been
reported, but their full length nature has not been determined.
[provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK223155.1, BC030155.2 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084 [ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
CDS uses downstream in-frame AUG :: downstream AUG is associated
with N-terminal localization
signal (PMID:9571159)
##RefSeq-Attributes-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-579 DA477521.1 1-579
580-2315 AK223155.1 319-2054
2316-2354 CK903484.1 1-39 c
FEATURES Location/Qualifiers
source 1..2354
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="8"
/map="8q24"
gene 1..2354
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/note="tumor necrosis factor receptor superfamily, member
11b"
/db_xref="GeneID:4982"
/db_xref="HGNC:11909"
/db_xref="MIM:602643"
exon 1..353
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/inference="alignment:Splign:1.39.8"
variation 26
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="a"
/replace="c"
/db_xref="dbSNP:11575930"
variation 40
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="c"
/replace="t"
/db_xref="dbSNP:11575929"
variation 101
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="c"
/replace="t"
/db_xref="dbSNP:2073617"
variation 124
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="a"
/replace="c"
/db_xref="dbSNP:11573807"
misc_feature 192..194
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/note="upstream in-frame stop codon"
misc_feature 257
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/note="major transcription initiation site"
variation 292
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="a"
/replace="c"
/db_xref="dbSNP:1050927"
CDS 324..1529
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/note="osteoprotegerin; osteoclastogenesis inhibitory
factor"
/codon_start=1
/product="tumor necrosis factor receptor superfamily
member 11B precursor"
/protein_id="NP_002537.3"
/db_xref="GI:148743793"
/db_xref="CCDS:CCDS6326.1"
/db_xref="GeneID:4982"
/db_xref="HGNC:11909"
/db_xref="MIM:602643"
/translation="
MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
"
sig_peptide 324..386
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
mat_peptide 387..1526
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/product="tumor necrosis factor receptor superfamily
member 11B"
misc_feature 393..509
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (O00300.3);
Region: TNFR-Cys 1"
misc_feature 405..695
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/note="Tumor necrosis factor receptor (TNFR) domain;
superfamily of TNF-like receptor domains. When bound to
TNF-like cytokines, TNFRs trigger multiple signal
transduction pathways, they are involved in inflammation
response, apoptosis, autoimmunity and...; Region: TNFR;
cd00185"
/db_xref="CDD:29147"
misc_feature order(405..410,531..533,564..566,594..596,675..677)
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/note="antiparallel homodimerization interface
[polypeptide binding]; other site"
/db_xref="CDD:29147"
misc_feature order(417..419,447..449,459..461,465..467,504..506,
513..515,543..545)
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/note="parallel homodimerization interface [polypeptide
binding]; other site"
/db_xref="CDD:29147"
misc_feature order(447..476,501..515,615..623)
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/note="protein binding site [polypeptide binding]; other
site"
/db_xref="CDD:29147"
misc_feature 516..638
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (O00300.3);
Region: TNFR-Cys 2"
misc_feature order(540..545,561..569)
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/note="50's loop TNF binding site; other site"
/db_xref="CDD:29147"
misc_feature 642..749
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (O00300.3);
Region: TNFR-Cys 3"
misc_feature 693..>878
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/note="Tumor necrosis factor receptor (TNFR) domain;
superfamily of TNF-like receptor domains. When bound to
TNF-like cytokines, TNFRs trigger multiple signal
transduction pathways, they are involved in inflammation
response, apoptosis, autoimmunity and...; Region: TNFR;
cl12111"
/db_xref="CDD:209448"
misc_feature order(693..716,741..755,855..863)
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/note="protein binding site [polypeptide binding]; other
site"
/db_xref="CDD:29147"
misc_feature order(699..701,705..707,744..746,753..755,783..785)
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/note="parallel homodimerization interface [polypeptide
binding]; other site"
/db_xref="CDD:29147"
misc_feature 756..878
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (O00300.3);
Region: TNFR-Cys 4"
misc_feature order(780..785,801..809)
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/note="50's loop TNF binding site; other site"
/db_xref="CDD:29147"
misc_feature 1200..1418
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/note="Death domain; Region: Death; pfam00531"
/db_xref="CDD:201284"
misc_feature 1521..1523
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/experiment="experimental evidence, no additional details
recorded"
/note="Involved in dimerization; propagated from
UniProtKB/Swiss-Prot (O00300.3); other site"
variation 332
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="c"
/replace="g"
/db_xref="dbSNP:2073618"
exon 354..723
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/inference="alignment:Splign:1.39.8"
variation 633
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="a"
/replace="g"
/db_xref="dbSNP:11573906"
exon 724..915
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/inference="alignment:Splign:1.39.8"
variation 881
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="c"
/replace="t"
/db_xref="dbSNP:11573923"
exon 916..1140
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/inference="alignment:Splign:1.39.8"
variation 1037
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="a"
/replace="g"
/db_xref="dbSNP:11573930"
variation 1091
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="a"
/replace="g"
/db_xref="dbSNP:2228568"
variation 1106
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:61761330"
variation 1111
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="a"
/replace="c"
/db_xref="dbSNP:1131380"
exon 1141..2346
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/inference="alignment:Splign:1.39.8"
STS 1185..1508
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/standard_name="PMC153764P1"
/db_xref="UniSTS:271270"
variation 1208
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="a"
/replace="t"
/db_xref="dbSNP:11573942"
variation 1316
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="g"
/replace="t"
/db_xref="dbSNP:1804853"
variation 1473
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="c"
/replace="t"
/db_xref="dbSNP:1804854"
STS 1520..1654
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/standard_name="RH93303"
/db_xref="UniSTS:87881"
variation 1551
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="c"
/replace="t"
/db_xref="dbSNP:11573943"
variation 1596
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="c"
/replace="t"
/db_xref="dbSNP:11573944"
variation 1825
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="g"
/replace="t"
/db_xref="dbSNP:3094021"
variation 1901
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="a"
/replace="c"
/db_xref="dbSNP:11573945"
variation 1986
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="g"
/replace="t"
/db_xref="dbSNP:3094022"
variation 2056
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="a"
/replace="g"
/db_xref="dbSNP:11573946"
variation 2074
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="c"
/replace="t"
/db_xref="dbSNP:11573947"
variation 2241
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
/replace="a"
/replace="g"
/db_xref="dbSNP:11573948"
polyA_signal 2322..2327
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
polyA_site 2346
/gene="TNFRSF11B"
/gene_synonym="OCIF; OPG; TR1"
ORIGIN
tttttttcccctgctctcccaggggccagacaccaccgccccacccctcacgccccacctccctgggggatcctttccgccccagccctgaaagcgttaaccctggagctttctgcacaccccccgaccgctcccgcccaagcttcctaaaaaagaaaggtgcaaagtttggtccaggatagaaaaatgactgatcaaaggcaggcgatacttcctgttgccgggacgctatatataacgtgatgagcgcacgggctgcggagacgcaccggagcgctcgcccagccgccgcctccaagcccctgaggtttccggggaccacaatgaacaacttgctgtgctgcgcgctcgtgtttctggacatctccattaagtggaccacccaggaaacgtttcctccaaagtaccttcattatgacgaagaaacctctcatcagctgttgtgtgacaaatgtcctcctggtacctacctaaaacaacactgtacagcaaagtggaagaccgtgtgcgccccttgccctgaccactactacacagacagctggcacaccagtgacgagtgtctatactgcagccccgtgtgcaaggagctgcagtacgtcaagcaggagtgcaatcgcacccacaaccgcgtgtgcgaatgcaaggaagggcgctaccttgagatagagttctgcttgaaacataggagctgccctcctggatttggagtggtgcaagctggaaccccagagcgaaatacagtttgcaaaagatgtccagatgggttcttctcaaatgagacgtcatctaaagcaccctgtagaaaacacacaaattgcagtgtctttggtctcctgctaactcagaaaggaaatgcaacacacgacaacatatgttccggaaacagtgaatcaactcaaaaatgtggaatagatgttaccctgtgtgaggaggcattcttcaggtttgctgttcctacaaagtttacgcctaactggcttagtgtcttggtagacaatttgcctggcaccaaagtaaacgcagagagtgtagagaggataaaacggcaacacagctcacaagaacagactttccagctgctgaagttatggaaacatcaaaacaaagaccaagatatagtcaagaagatcatccaagatattgacctctgtgaaaacagcgtgcagcggcacattggacatgctaacctcaccttcgagcagcttcgtagcttgatggaaagcttaccgggaaagaaagtgggagcagaagacattgaaaaaacaataaaggcatgcaaacccagtgaccagatcctgaagctgctcagtttgtggcgaataaaaaatggcgaccaagacaccttgaagggcctaatgcacgcactaaagcactcaaagacgtaccactttcccaaaactgtcactcagagtctaaagaagaccatcaggttccttcacagcttcacaatgtacaaattgtatcagaagttatttttagaaatgataggtaaccaggtccaatcagtaaaaataagctgcttataactggaaatggccattgagctgtttcctcacaattggcgagatcccatggatgagtaaactgtttctcaggcacttgaggctttcagtgatatctttctcattaccagtgactaattttgccacagggtactaaaagaaactatgatgtggagaaaggactaacatctcctccaataaaccccaaatggttaatccaactgtcagatctggatcgttatctactgactatattttcccttattactgcttgcagtaattcaactggaaattaaaaaaaaaaaactagactccattgtgccttactaaatatgggaatgtctaacttaaatagctttgagatttcagctatgctagaggcttttattagaaagccatatttttttctgtaaaagttactaatatatctgtaacactattacagtattgctatttatattcattcagatataagatttgtacatattatcatcctataaagaaacggtatgacttaattttagaaagaaaattatattctgtttattatgacaaatgaaagagaaaatatatatttttaatggaaagtttgtagcatttttctaataggtactgccatatttttctgtgtggagtatttttataattttatctgtataagctgtaatatcattttatagaaaatgcattatttagtcaattgtttaatgttggaaaacatatgaaatataaattatctgaatattagatgctctgagaaattgaatgtaccttatttaaaagattttatggttttataactatataaatgacattattaaagttttcaaattattttttaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:4982 -> Molecular function: GO:0004872 [receptor activity] evidence: TAS
GeneID:4982 -> Molecular function: GO:0005125 [cytokine activity] evidence: TAS
GeneID:4982 -> Biological process: GO:0001501 [skeletal system development] evidence: TAS
GeneID:4982 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:4982 -> Biological process: GO:0007165 [signal transduction] evidence: IEA
GeneID:4982 -> Biological process: GO:0007584 [response to nutrient] evidence: IEA
GeneID:4982 -> Biological process: GO:0030198 [extracellular matrix organization] evidence: IEA
GeneID:4982 -> Biological process: GO:0032026 [response to magnesium ion] evidence: IEA
GeneID:4982 -> Biological process: GO:0042489 [negative regulation of odontogenesis of dentin-containing tooth] evidence: IEA
GeneID:4982 -> Biological process: GO:0042493 [response to drug] evidence: IEA
GeneID:4982 -> Biological process: GO:0043627 [response to estrogen stimulus] evidence: IEA
GeneID:4982 -> Biological process: GO:0045779 [negative regulation of bone resorption] evidence: IEA
GeneID:4982 -> Biological process: GO:0046685 [response to arsenic-containing substance] evidence: IEA
GeneID:4982 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
GeneID:4982 -> Cellular component: GO:0005578 [proteinaceous extracellular matrix] evidence: IEA
GeneID:4982 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.