Home |
Help |
Advanced search
2024-04-27 03:58:33, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002190 1859 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens interleukin 17A (IL17A), mRNA.
ACCESSION NM_002190
VERSION NM_002190.2 GI:27477085
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1859)
AUTHORS Zizzo,G. and Cohen,P.L.
TITLE IL-17 stimulates differentiation of human anti-inflammatory
macrophages and phagocytosis of apoptotic neutrophils in response
to IL-10 and glucocorticoids
JOURNAL J. Immunol. 190 (10), 5237-5246 (2013)
PUBMED 23596310
REMARK GeneRIF: data support an unexpected role for IL-17 in orchestrating
resolution of innate inflammation.
REFERENCE 2 (bases 1 to 1859)
AUTHORS Olsen,I. and Sollid,L.M.
TITLE Pitfalls in determining the cytokine profile of human T cells
JOURNAL J. Immunol. Methods 390 (1-2), 106-112 (2013)
PUBMED 23416458
REMARK GeneRIF: Data indicate that the dose response curve for phorbol
12-myristate 13-acetate (PMA)/Ionomycin differed for IL-10 compared
to IL-17 and IFN-gamma production by T4 cells.
REFERENCE 3 (bases 1 to 1859)
AUTHORS Segura,E., Touzot,M., Bohineust,A., Cappuccio,A., Chiocchia,G.,
Hosmalin,A., Dalod,M., Soumelis,V. and Amigorena,S.
TITLE Human inflammatory dendritic cells induce Th17 cell differentiation
JOURNAL Immunity 38 (2), 336-348 (2013)
PUBMED 23352235
REMARK GeneRIF: Human inflammatory dendritic cells, but not inflammatory
macrophages, stimulated autologous memory CD4(+) T cells to produce
interleukin-17 and induce T helper 17 (Th17) cell differentiation.
REFERENCE 4 (bases 1 to 1859)
AUTHORS Li,J.R., Hong,F.Y., Zeng,J.Y. and Huang,G.L.
TITLE Functional interleukin-17 receptor A are present in the thyroid
gland in intractable Graves disease
JOURNAL Cell. Immunol. 281 (1), 85-90 (2013)
PUBMED 23501056
REMARK GeneRIF: Our data indicates that serum IL-17 levels are
significantly increased in intractable Graves disease and affected
thyrocytes show functional IL-17R expression.
REFERENCE 5 (bases 1 to 1859)
AUTHORS Du,W.J., Zhen,J.H., Zeng,Z.Q., Zheng,Z.M., Xu,Y., Qin,L.Y. and
Chen,S.J.
TITLE Expression of interleukin-17 associated with disease progression
and liver fibrosis with hepatitis B virus infection: IL-17 in HBV
infection
JOURNAL Diagn Pathol 8, 40 (2013)
PUBMED 23448394
REMARK GeneRIF: Suggest that IL-17 may not only induce the inflammation,
but also contribute to disease progression and chronicity in
hepatitis B infection.
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 1859)
AUTHORS Murphy,K.P. Jr., Gagne,P., Pazmany,C. and Moody,M.D.
TITLE Expression of human interleukin-17 in Pichia pastoris: purification
and characterization
JOURNAL Protein Expr. Purif. 12 (2), 208-214 (1998)
PUBMED 9518462
REFERENCE 7 (bases 1 to 1859)
AUTHORS Yao,Z., Spriggs,M.K., Derry,J.M., Strockbine,L., Park,L.S.,
VandenBos,T., Zappone,J.D., Painter,S.L. and Armitage,R.J.
TITLE Molecular characterization of the human interleukin (IL)-17
receptor
JOURNAL Cytokine 9 (11), 794-800 (1997)
PUBMED 9367539
REFERENCE 8 (bases 1 to 1859)
AUTHORS Fossiez,F., Djossou,O., Chomarat,P., Flores-Romo,L., Ait-Yahia,S.,
Maat,C., Pin,J.J., Garrone,P., Garcia,E., Saeland,S., Blanchard,D.,
Gaillard,C., Das Mahapatra,B., Rouvier,E., Golstein,P.,
Banchereau,J. and Lebecque,S.
TITLE T cell interleukin-17 induces stromal cells to produce
proinflammatory and hematopoietic cytokines
JOURNAL J. Exp. Med. 183 (6), 2593-2603 (1996)
PUBMED 8676080
REFERENCE 9 (bases 1 to 1859)
AUTHORS Yao,Z., Painter,S.L., Fanslow,W.C., Ulrich,D., Macduff,B.M.,
Spriggs,M.K. and Armitage,R.J.
TITLE Human IL-17: a novel cytokine derived from T cells
JOURNAL J. Immunol. 155 (12), 5483-5486 (1995)
PUBMED 7499828
REFERENCE 10 (bases 1 to 1859)
AUTHORS Rouvier,E., Luciani,M.F., Mattei,M.G., Denizot,F. and Golstein,P.
TITLE CTLA-8, cloned from an activated T cell, bearing AU-rich messenger
RNA instability sequences, and homologous to a herpesvirus saimiri
gene
JOURNAL J. Immunol. 150 (12), 5445-5456 (1993)
PUBMED 8390535
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from U32659.1.
This sequence is a reference standard in the RefSeqGene project.
On Jan 3, 2003 this sequence version replaced gi:4504650.
Summary: The protein encoded by this gene is a proinflammatory
cytokine produced by activated T cells. This cytokine regulates the
activities of NF-kappaB and mitogen-activated protein kinases. This
cytokine can stimulate the expression of IL6 and cyclooxygenase-2
(PTGS2/COX-2), as well as enhance the production of nitric oxide
(NO). High levels of this cytokine are associated with several
chronic inflammatory diseases including rheumatoid arthritis,
psoriasis and multiple sclerosis. [provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: U32659.1, Z58820.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025084, ERS025088 [ECO:0000350]
##Evidence-Data-END##
FEATURES Location/Qualifiers
source 1..1859
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="6"
/map="6p12"
gene 1..1859
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/note="interleukin 17A"
/db_xref="GeneID:3605"
/db_xref="HGNC:5981"
/db_xref="HPRD:04396"
/db_xref="MIM:603149"
exon 1..72
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/inference="alignment:Splign:1.39.8"
variation 16
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="t"
/db_xref="dbSNP:375071669"
misc_feature 28..30
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/note="upstream in-frame stop codon"
CDS 46..513
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/note="interleukin 17; interleukin 17 (cytotoxic
T-lymphocyte-associated serine esterase 8); cytotoxic
T-lymphocyte-associated protein 8; cytotoxic
T-lymphocyte-associated antigen 8; CTLA-8"
/codon_start=1
/product="interleukin-17A precursor"
/protein_id="NP_002181.1"
/db_xref="GI:4504651"
/db_xref="CCDS:CCDS4937.1"
/db_xref="GeneID:3605"
/db_xref="HGNC:5981"
/db_xref="HPRD:04396"
/db_xref="MIM:603149"
/translation="
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
"
sig_peptide 46..114
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
mat_peptide 115..510
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/product="interleukin-17A"
misc_feature 247..489
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/note="Interleukin-17; Region: IL17; pfam06083"
/db_xref="CDD:191444"
variation 54
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="g"
/replace="t"
/db_xref="dbSNP:199815459"
exon 73..275
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/inference="alignment:Splign:1.39.8"
variation 99
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:146341554"
variation 104
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="t"
/db_xref="dbSNP:369300495"
variation 130
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="t"
/db_xref="dbSNP:139620979"
variation 131
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:144233360"
variation 168
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="t"
/db_xref="dbSNP:373916128"
variation 186
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="t"
/db_xref="dbSNP:146063079"
variation 206
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:201890924"
variation 242
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:148704956"
variation 250
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="t"
/db_xref="dbSNP:187415143"
variation 257
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="t"
/db_xref="dbSNP:138238811"
exon 276..1859
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/inference="alignment:Splign:1.39.8"
variation 304
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="g"
/replace="t"
/db_xref="dbSNP:372751013"
variation 316
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:151317528"
variation 328
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="t"
/db_xref="dbSNP:199987410"
variation 334
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="t"
/db_xref="dbSNP:371175650"
variation 343
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="c"
/db_xref="dbSNP:375068948"
variation 385
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="g"
/db_xref="dbSNP:139375510"
variation 413
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:145530358"
variation 446
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:147810050"
variation 447
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:17880588"
variation 461
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="t"
/db_xref="dbSNP:199827182"
variation 468
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="t"
/db_xref="dbSNP:17878530"
variation 471
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:367966439"
variation 489
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="c"
/db_xref="dbSNP:201642273"
variation 530
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="c"
/db_xref="dbSNP:200987402"
variation 547
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="t"
/db_xref="dbSNP:372199001"
variation 553
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="t"
/db_xref="dbSNP:373281866"
variation 672
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:7747909"
variation 684
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="c"
/db_xref="dbSNP:115651024"
variation 705
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="t"
/db_xref="dbSNP:139300148"
variation 737
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:371003208"
variation 1040
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:116183687"
variation 1096
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:190668927"
variation 1179
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="c"
/db_xref="dbSNP:181990814"
STS 1401..1654
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/standard_name="RH18032"
/db_xref="UniSTS:72092"
variation 1421
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:185351555"
variation 1424
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="t"
/db_xref="dbSNP:144150158"
variation 1552
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="t"
/db_xref="dbSNP:17886754"
variation 1628
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="t"
/db_xref="dbSNP:149523568"
variation 1643
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:147546614"
variation 1669
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace=""
/replace="t"
/db_xref="dbSNP:11351315"
variation 1697
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="c"
/replace="g"
/db_xref="dbSNP:77971944"
variation 1716
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="g"
/replace="t"
/db_xref="dbSNP:17883570"
variation 1758
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:1974226"
variation 1762
/gene="IL17A"
/gene_synonym="CTLA8; IL-17; IL-17A; IL17"
/replace="a"
/replace="g"
/db_xref="dbSNP:3748067"
ORIGIN
gcaggcacaaactcatccatccccagttgattggaagaaacaacgatgactcctgggaagacctcattggtgtcactgctactgctgctgagcctggaggccatagtgaaggcaggaatcacaatcccacgaaatccaggatgcccaaattctgaggacaagaacttcccccggactgtgatggtcaacctgaacatccataaccggaataccaataccaatcccaaaaggtcctcagattactacaaccgatccacctcaccttggaatctccaccgcaatgaggaccctgagagatatccctctgtgatctgggaggcaaagtgccgccacttgggctgcatcaacgctgatgggaacgtggactaccacatgaactctgtccccatccagcaagagatcctggtcctgcgcagggagcctccacactgccccaactccttccggctggagaagatactggtgtccgtgggctgcacctgtgtcaccccgattgtccaccatgtggcctaagagctctggggagcccacactccccaaagcagttagactatggagagccgacccagcccctcaggaaccctcatccttcaaagacagcctcatttcggactaaactcattagagttcttaaggcagtttgtccaattaaagcttcagaggtaacacttggccaagatatgagatctgaattacctttccctctttccaagaaggaaggtttgactgagtaccaatttgcttcttgtttacttttttaagggctttaagttatttatgtatttaatatgccctgagataactttggggtataagattccattttaatgaattacctactttattttgtttgtctttttaaagaagataagattctgggcttgggaattttattatttaaaaggtaaaacctgtatttatttgagctatttaaggatctatttatgtttaagtatttagaaaaaggtgaaaaagcactattatcagttctgcctaggtaaatgtaagatagaattaaatggcagtgcaaaatttctgagtctttacaacatacggatatagtatttcctcctctttgtttttaaaagttataacatggctgaaaagaaagattaaacctactttcatatgtattaatttaaattttgcaatttgttgaggttttacaagagatacagcaagtctaactctctgttccattaaacccttataataaaatccttctgtaataataaagtttcaaaagaaaatgtttatttgttctcattaaatgtattttagcaaactcagctcttccctattgggaagagttatgcaaattctcctataagcaaaacaaagcatgtctttgagtaacaatgacctggaaatacccaaaattccaagttctcgatttcacatgccttcaagactgaacaccgactaaggttttcatactattagccaatgctgtagacagaagcattttgataggaatagagcaaataagataatggccctgaggaatggcatgtcattattaaagatcatatggggaaaatgaaaccctccccaaaatacaagaagttctgggaggagacattgtcttcagactacaatgtccagtttctcccctagactcaggcttcctttggagattaaggcccctcagagatcaacagaccaacatttttctcttcctcaagcaacactcctagggcctggcttctgtctgatcaaggcaccacacaacccagaaaggagctgatggggcagaacgaactttaagtatgagaaaagttcagcccaagtaaaataaaaactcaatcacattcaattccagagtagtttcaagtttcacatcgtaaccattttcgccc
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:3605 -> Molecular function: GO:0005125 [cytokine activity] evidence: IEA
GeneID:3605 -> Biological process: GO:0006486 [protein glycosylation] evidence: TAS
GeneID:3605 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:3605 -> Biological process: GO:0006954 [inflammatory response] evidence: IEA
GeneID:3605 -> Biological process: GO:0006955 [immune response] evidence: TAS
GeneID:3605 -> Biological process: GO:0007267 [cell-cell signaling] evidence: TAS
GeneID:3605 -> Biological process: GO:0008219 [cell death] evidence: TAS
GeneID:3605 -> Biological process: GO:0032747 [positive regulation of interleukin-23 production] evidence: IDA
GeneID:3605 -> Biological process: GO:0045672 [positive regulation of osteoclast differentiation] evidence: IDA
GeneID:3605 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IDA
GeneID:3605 -> Biological process: GO:0071347 [cellular response to interleukin-1] evidence: IEA
GeneID:3605 -> Biological process: GO:0072537 [fibroblast activation] evidence: IDA
GeneID:3605 -> Biological process: GO:1900017 [positive regulation of cytokine production involved in inflammatory response] evidence: IEA
GeneID:3605 -> Cellular component: GO:0005615 [extracellular space] evidence: IEA
GeneID:3605 -> Cellular component: GO:0009897 [external side of plasma membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.