Home |
Help |
Advanced search
2024-04-24 09:54:53, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002166 1402 bp mRNA linear PRI 01-JUL-2013
DEFINITION Homo sapiens inhibitor of DNA binding 2, dominant negative
helix-loop-helix protein (ID2), mRNA.
ACCESSION NM_002166
VERSION NM_002166.4 GI:33946335
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1402)
AUTHORS Wazir,U., Jiang,W.G., Sharma,A.K., Newbold,R.F. and Mokbel,K.
TITLE The mRNA expression of inhibitors of DNA binding-1 and -2 is
associated with advanced tumour stage and adverse clinical outcome
in human breast cancer
JOURNAL Anticancer Res. 33 (5), 2179-2183 (2013)
PUBMED 23645773
REMARK GeneRIF: Higher ID2 expression was associated with advanced breast
cancer.
REFERENCE 2 (bases 1 to 1402)
AUTHORS Luo,M., Li,Z., Wang,W., Zeng,Y., Liu,Z. and Qiu,J.
TITLE Upregulated H19 contributes to bladder cancer cell proliferation by
regulating ID2 expression
JOURNAL FEBS J. 280 (7), 1709-1716 (2013)
PUBMED 23399020
REMARK GeneRIF: upregulated H19 increases bladder cancer growth by
regulating ID2 expression
REFERENCE 3 (bases 1 to 1402)
AUTHORS Wong,M.V., Palasingam,P. and Kolatkar,P.R.
TITLE Cloning, purification and preliminary X-ray data analysis of the
human ID2 homodimer
JOURNAL Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 68 (PT 11),
1354-1358 (2012)
PUBMED 23143248
REMARK GeneRIF: preliminary X-ray data analysis of the human ID2 homodimer
REFERENCE 4 (bases 1 to 1402)
AUTHORS Wong,M.V., Jiang,S., Palasingam,P. and Kolatkar,P.R.
TITLE A divalent ion is crucial in the structure and dominant-negative
function of ID proteins, a class of helix-loop-helix transcription
regulators
JOURNAL PLoS ONE 7 (10), E48591 (2012)
PUBMED 23119064
REMARK GeneRIF: Data indicate that ID2.K47A, ID2.Q55A and ID3.R52A,
ID3.R60A had wildtype like expression levels in E. coli.
REFERENCE 5 (bases 1 to 1402)
AUTHORS Lasorella,A., Iavarone,A. and Israel,M.A.
TITLE Id2 specifically alters regulation of the cell cycle by tumor
suppressor proteins
JOURNAL Mol. Cell. Biol. 16 (6), 2570-2578 (1996)
PUBMED 8649364
REFERENCE 6 (bases 1 to 1402)
AUTHORS Mathew,S., Chen,W., Murty,V.V., Benezra,R. and Chaganti,R.S.
TITLE Chromosomal assignment of human ID1 and ID2 genes
JOURNAL Genomics 30 (2), 385-387 (1995)
PUBMED 8586447
REFERENCE 7 (bases 1 to 1402)
AUTHORS Iavarone,A., Garg,P., Lasorella,A., Hsu,J. and Israel,M.A.
TITLE The helix-loop-helix protein Id-2 enhances cell proliferation and
binds to the retinoblastoma protein
JOURNAL Genes Dev. 8 (11), 1270-1284 (1994)
PUBMED 7926730
REFERENCE 8 (bases 1 to 1402)
AUTHORS Hara,E., Yamaguchi,T., Nojima,H., Ide,T., Campisi,J., Okayama,H.
and Oda,K.
TITLE Id-related genes encoding helix-loop-helix proteins are required
for G1 progression and are repressed in senescent human fibroblasts
JOURNAL J. Biol. Chem. 269 (3), 2139-2145 (1994)
PUBMED 8294468
REFERENCE 9 (bases 1 to 1402)
AUTHORS Kurabayashi,M., Jeyaseelan,R. and Kedes,L.
TITLE Two distinct cDNA sequences encoding the human helix-loop-helix
protein Id2
JOURNAL Gene 133 (2), 305-306 (1993)
PUBMED 8224921
REFERENCE 10 (bases 1 to 1402)
AUTHORS Biggs,J., Murphy,E.V. and Israel,M.A.
TITLE A human Id-like helix-loop-helix protein expressed during early
development
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 89 (4), 1512-1516 (1992)
PUBMED 1741406
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BC030639.2 and BE222494.1.
On Aug 20, 2003 this sequence version replaced gi:32307101.
Summary: The protein encoded by this gene belongs to the inhibitor
of DNA binding family, members of which are transcriptional
regulators that contain a helix-loop-helix (HLH) domain but not a
basic domain. Members of the inhibitor of DNA binding family
inhibit the functions of basic helix-loop-helix transcription
factors in a dominant-negative manner by suppressing their
heterodimerization partners through the HLH domains. This protein
may play a role in negatively regulating cell differentiation. A
pseudogene of this gene is located on chromosome 3. [provided by
RefSeq, Aug 2011].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC030639.2, BX377633.2 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers
source 1..1402
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="2"
/map="2p25"
gene 1..1402
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/note="inhibitor of DNA binding 2, dominant negative
helix-loop-helix protein"
/db_xref="GeneID:3398"
/db_xref="HGNC:5361"
/db_xref="HPRD:02664"
/db_xref="MIM:600386"
exon 1..531
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/inference="alignment:Splign:1.39.8"
variation 6
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:115236910"
variation 43
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:147849051"
variation 53
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:181038180"
variation 55
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="g"
/db_xref="dbSNP:56298521"
variation 99
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="g"
/db_xref="dbSNP:370253509"
variation 131
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:367667941"
variation 152
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:370283962"
variation 153
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:374730683"
variation 154
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:56393729"
variation 172
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="g"
/db_xref="dbSNP:371697958"
variation 178
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:376944573"
CDS 184..588
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/note="inhibitor of differentiation 2; DNA-binding protein
inhibitor ID2; helix-loop-helix protein ID2; cell
growth-inhibiting gene 8; class B basic helix-loop-helix
protein 26"
/codon_start=1
/product="DNA-binding protein inhibitor ID-2"
/protein_id="NP_002157.2"
/db_xref="GI:31982933"
/db_xref="CCDS:CCDS1659.1"
/db_xref="GeneID:3398"
/db_xref="HGNC:5361"
/db_xref="HPRD:02664"
/db_xref="MIM:600386"
/translation="
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
"
misc_feature 196..198
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:00310"
misc_feature <295..423
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/note="Helix-loop-helix domain, found in specific DNA-
binding proteins that act as transcription factors; 60-100
amino acids long. A DNA-binding basic region is followed
by two alpha-helices separated by a variable loop region;
HLH forms homo- and heterodimers; Region: HLH; cd00083"
/db_xref="CDD:28964"
misc_feature order(295..300,307..312,316..321,367..369,376..378,
388..390,394..399,409..411,415..420)
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/note="dimerization interface [polypeptide binding]; other
site"
/db_xref="CDD:28964"
misc_feature 499..528
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q02363.1);
Region: Nuclear export signal (By similarity)"
variation 195
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:200785774"
variation 209
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:11545142"
variation 212
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="t"
/db_xref="dbSNP:372237811"
variation 221..222
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace=""
/replace="c"
/db_xref="dbSNP:376976756"
variation 224
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:186122483"
variation 229
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:377120348"
variation 237
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:141179746"
variation 263
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="c"
/db_xref="dbSNP:200831448"
variation 264
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:369813445"
variation 286
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:114406044"
variation 303
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:374854911"
variation 306
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:369294315"
variation 360
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:149826728"
variation 369
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:372837543"
variation 376
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:375848588"
variation 380
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:370458191"
STS 390..593
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/standard_name="RH67912"
/db_xref="UniSTS:39848"
variation 399
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:148245442"
variation 405
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:150794270"
variation 415
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:373045012"
variation 485
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:200965294"
variation 501
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:4899"
STS 523..937
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/standard_name="D3S4003"
/db_xref="UniSTS:67215"
exon 532..595
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/inference="alignment:Splign:1.39.8"
variation 544
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:200461867"
variation 547
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="t"
/db_xref="dbSNP:201247626"
variation 566
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:367911935"
variation 574
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:372117829"
exon 596..1364
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/inference="alignment:Splign:1.39.8"
STS 604..1314
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/standard_name="ID2_2310"
/db_xref="UniSTS:280771"
variation 605
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:188919269"
variation 623..625
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace=""
/replace="aca"
/db_xref="dbSNP:376422302"
variation 662
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="g"
/db_xref="dbSNP:192378104"
variation 665
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="g"
/replace="t"
/db_xref="dbSNP:184340832"
variation 716..717
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="t"
/db_xref="dbSNP:1064653"
variation 723
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace=""
/replace="a"
/db_xref="dbSNP:371946564"
variation 757
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:187229888"
STS 811..913
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/standard_name="RH11441"
/db_xref="UniSTS:87477"
variation 871
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:1802549"
variation 876
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:1802550"
variation 975..979
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace=""
/replace="aaatg"
/db_xref="dbSNP:140487184"
variation 1085..1088
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace=""
/replace="atta"
/db_xref="dbSNP:56114166"
variation 1099
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:371228469"
STS 1106..1243
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/standard_name="D2S208E"
/db_xref="UniSTS:147792"
variation 1115
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:192055392"
variation 1119..1120
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace=""
/replace="at"
/db_xref="dbSNP:56392909"
STS 1142..1302
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/standard_name="RH25021"
/db_xref="UniSTS:92939"
variation 1149
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="t"
/db_xref="dbSNP:184949920"
variation 1151..1154
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace=""
/replace="attc"
/db_xref="dbSNP:373341223"
variation 1151
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="t"
/db_xref="dbSNP:13401658"
variation 1251..1252
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace=""
/replace="ca"
/db_xref="dbSNP:150333363"
variation 1293
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="t"
/db_xref="dbSNP:375466228"
variation 1333
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="a"
/replace="g"
/db_xref="dbSNP:56050726"
polyA_signal 1343..1348
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
variation 1350
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
/replace="c"
/replace="g"
/db_xref="dbSNP:147763639"
polyA_site 1364
/gene="ID2"
/gene_synonym="bHLHb26; GIG8; ID2A; ID2H"
ORIGIN
ggggacgaagggaagctccagcgtgtggccccggcgagtgcggataaaagccgccccgccgggctcgggcttcattctgagccgagcccggtgccaagcgcagctagctcagcaggcggcagcggcggcctgagcttcagggcagccagctccctcccggtctcgccttccctcgcggtcagcatgaaagccttcagtcccgtgaggtccgttaggaaaaacagcctgtcggaccacagcctgggcatctcccggagcaaaacccctgtggacgacccgatgagcctgctatacaacatgaacgactgctactccaagctcaaggagctggtgcccagcatcccccagaacaagaaggtgagcaagatggaaatcctgcagcacgtcatcgactacatcttggacctgcagatcgccctggactcgcatcccactattgtcagcctgcatcaccagagacccgggcagaaccaggcgtccaggacgccgctgaccaccctcaacacggatatcagcatcctgtccttgcaggcttctgaattcccttctgagttaatgtcaaatgacagcaaagcactgtgtggctgaataagcggtgttcatgatttcttttattctttgcacaacaacaacaacaacaaattcacggaatcttttaagtgctgaacttatttttcaaccatttcacaaggaggacaagttgaatggacctttttaaaaagaaaaaaaaaatggaaggaaaactaagaatgatcatcttcccagggtgttctcttacttggactgtgatattcgttatttatgaaaaagacttttaaatgccctttctgcagttggaaggttttctttatatactattcccaccatggggagcgaaaacgttaaaatcacaaggaattgcccaatctaagcagactttgccttttttcaaaggtggagcgtgaataccagaaggatccagtattcagtcacttaaatgaagtcttttggtcagaaattacctttttgacacaagcctactgaatgctgtgtatatatttatatataaatatatctatttgagtgaaaccttgtgaactctttaattagagttttcttgtatagtggcagagatgtctatttctgcattcaaaagtgtaatgatgtacttattcatgctaaactttttataaaagtttagttgtaaacttaacccttttatacaaaataaatcaagtgtgtttattgaatggtgattgcctgctttatttcagaggaccagtgctttgatttttattatgctatgttataactgaacccaaataaatacaagttcaaatttatgtagactgtataagattataataaaacatgtctgaagtcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:3398 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:3398 -> Molecular function: GO:0044325 [ion channel binding] evidence: IPI
GeneID:3398 -> Molecular function: GO:0046983 [protein dimerization activity] evidence: IEA
GeneID:3398 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: IEA
GeneID:3398 -> Biological process: GO:0001656 [metanephros development] evidence: IEA
GeneID:3398 -> Biological process: GO:0001779 [natural killer cell differentiation] evidence: IEA
GeneID:3398 -> Biological process: GO:0003149 [membranous septum morphogenesis] evidence: IEA
GeneID:3398 -> Biological process: GO:0003166 [bundle of His development] evidence: IEA
GeneID:3398 -> Biological process: GO:0007275 [multicellular organismal development] evidence: TAS
GeneID:3398 -> Biological process: GO:0009649 [entrainment of circadian clock] evidence: IEA
GeneID:3398 -> Biological process: GO:0010628 [positive regulation of gene expression] evidence: ISS
GeneID:3398 -> Biological process: GO:0010629 [negative regulation of gene expression] evidence: ISS
GeneID:3398 -> Biological process: GO:0014003 [oligodendrocyte development] evidence: IEA
GeneID:3398 -> Biological process: GO:0019216 [regulation of lipid metabolic process] evidence: IEA
GeneID:3398 -> Biological process: GO:0021772 [olfactory bulb development] evidence: IEA
GeneID:3398 -> Biological process: GO:0033598 [mammary gland epithelial cell proliferation] evidence: ISS
GeneID:3398 -> Biological process: GO:0043353 [enucleate erythrocyte differentiation] evidence: IEA
GeneID:3398 -> Biological process: GO:0043392 [negative regulation of DNA binding] evidence: IEA
GeneID:3398 -> Biological process: GO:0043433 [negative regulation of sequence-specific DNA binding transcription factor activity] evidence: IDA
GeneID:3398 -> Biological process: GO:0045578 [negative regulation of B cell differentiation] evidence: IEA
GeneID:3398 -> Biological process: GO:0045600 [positive regulation of fat cell differentiation] evidence: IEA
GeneID:3398 -> Biological process: GO:0045648 [positive regulation of erythrocyte differentiation] evidence: IEA
GeneID:3398 -> Biological process: GO:0045651 [positive regulation of macrophage differentiation] evidence: IEA
GeneID:3398 -> Biological process: GO:0045665 [negative regulation of neuron differentiation] evidence: ISS
GeneID:3398 -> Biological process: GO:0045668 [negative regulation of osteoblast differentiation] evidence: IEA
GeneID:3398 -> Biological process: GO:0045777 [positive regulation of blood pressure] evidence: ISS
GeneID:3398 -> Biological process: GO:0045787 [positive regulation of cell cycle] evidence: IEA
GeneID:3398 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: IDA
GeneID:3398 -> Biological process: GO:0045893 [positive regulation of transcription, DNA-dependent] evidence: ISS
GeneID:3398 -> Biological process: GO:0048469 [cell maturation] evidence: IEA
GeneID:3398 -> Biological process: GO:0048541 [Peyer's patch development] evidence: IEA
GeneID:3398 -> Biological process: GO:0048557 [embryonic digestive tract morphogenesis] evidence: ISS
GeneID:3398 -> Biological process: GO:0048661 [positive regulation of smooth muscle cell proliferation] evidence: ISS
GeneID:3398 -> Biological process: GO:0048663 [neuron fate commitment] evidence: ISS
GeneID:3398 -> Biological process: GO:0048711 [positive regulation of astrocyte differentiation] evidence: IEA
GeneID:3398 -> Biological process: GO:0048715 [negative regulation of oligodendrocyte differentiation] evidence: IEA
GeneID:3398 -> Biological process: GO:0060612 [adipose tissue development] evidence: IEA
GeneID:3398 -> Biological process: GO:0060749 [mammary gland alveolus development] evidence: ISS
GeneID:3398 -> Biological process: GO:0061030 [epithelial cell differentiation involved in mammary gland alveolus development] evidence: ISS
GeneID:3398 -> Biological process: GO:0061031 [endodermal digestive tract morphogenesis] evidence: ISS
GeneID:3398 -> Biological process: GO:0071158 [positive regulation of cell cycle arrest] evidence: ISS
GeneID:3398 -> Biological process: GO:0071285 [cellular response to lithium ion] evidence: IEA
GeneID:3398 -> Biological process: GO:0071931 [positive regulation of transcription involved in G1/S phase of mitotic cell cycle] evidence: IC
GeneID:3398 -> Biological process: GO:0090398 [cellular senescence] evidence: ISS
GeneID:3398 -> Biological process: GO:2000045 [regulation of G1/S transition of mitotic cell cycle] evidence: IMP
GeneID:3398 -> Biological process: GO:2000178 [negative regulation of neural precursor cell proliferation] evidence: ISS
GeneID:3398 -> Cellular component: GO:0000785 [chromatin] evidence: IEA
GeneID:3398 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:3398 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
GeneID:3398 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:3398 -> Cellular component: GO:0005829 [cytosol] evidence: IDA
GeneID:3398 -> Cellular component: GO:0043234 [protein complex] evidence: ISS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.