Home |
Help |
Advanced search
2024-04-20 00:11:51, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_002165 1000 bp mRNA linear PRI 15-JUL-2013
DEFINITION Homo sapiens inhibitor of DNA binding 1, dominant negative
helix-loop-helix protein (ID1), transcript variant 1, mRNA.
ACCESSION NM_002165
VERSION NM_002165.3 GI:341865544
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1000)
AUTHORS Wazir,U., Jiang,W.G., Sharma,A.K., Newbold,R.F. and Mokbel,K.
TITLE The mRNA expression of inhibitors of DNA binding-1 and -2 is
associated with advanced tumour stage and adverse clinical outcome
in human breast cancer
JOURNAL Anticancer Res. 33 (5), 2179-2183 (2013)
PUBMED 23645773
REMARK GeneRIF: Higher ID1 expression was associated with advanced breast
cancer.
REFERENCE 2 (bases 1 to 1000)
AUTHORS Strong,N., Millena,A.C., Walker,L., Chaudhary,J. and Khan,S.A.
TITLE Inhibitor of differentiation 1 (Id1) and Id3 proteins play
different roles in TGFbeta effects on cell proliferation and
migration in prostate cancer cells
JOURNAL Prostate 73 (6), 624-633 (2013)
PUBMED 23060149
REMARK GeneRIF: These findings suggest an essential role of Id1 and Id3 in
TGFbeta1 effects on proliferation and migration in prostate cancer
cells.
REFERENCE 3 (bases 1 to 1000)
AUTHORS Soroceanu,L., Murase,R., Limbad,C., Singer,E., Allison,J.,
Adrados,I., Kawamura,R., Pakdel,A., Fukuyo,Y., Nguyen,D., Khan,S.,
Arauz,R., Yount,G.L., Moore,D.H., Desprez,P.Y. and McAllister,S.D.
TITLE Id-1 is a key transcriptional regulator of glioblastoma
aggressiveness and a novel therapeutic target
JOURNAL Cancer Res. 73 (5), 1559-1569 (2013)
PUBMED 23243024
REMARK GeneRIF: Our results suggest that Id-1 regulates multiple
tumor-promoting pathways in glioblastoma
REFERENCE 4 (bases 1 to 1000)
AUTHORS Trevino,J.G., Pillai,S., Kunigal,S., Singh,S., Fulp,W.J.,
Centeno,B.A. and Chellappan,S.P.
TITLE Nicotine induces inhibitor of differentiation-1 in a Src-dependent
pathway promoting metastasis and chemoresistance in pancreatic
adenocarcinoma
JOURNAL Neoplasia 14 (12), 1102-1114 (2012)
PUBMED 23308043
REMARK GeneRIF: Results suggests a definite role for Id1 in mediating
nicotine-induced proliferation and invasion of pancreatic cancer
cells.
REFERENCE 5 (bases 1 to 1000)
AUTHORS Ao,J., Meng,J., Zhu,L., Nie,H., Yang,C., Li,J., Gu,J., Lin,Q.,
Long,W., Dong,X. and Li,C.
TITLE Activation of androgen receptor induces ID1 and promotes
hepatocellular carcinoma cell migration and invasion
JOURNAL Mol Oncol 6 (5), 507-515 (2012)
PUBMED 22819717
REMARK GeneRIF: shRNA knockdown of ID1 attenuates androgen-stimulated
hepatocellular carcinoma cell migration and invasion.
REFERENCE 6 (bases 1 to 1000)
AUTHORS Nehlin,J.O., Hara,E., Kuo,W.L., Collins,C. and Campisi,J.
TITLE Genomic organization, sequence, and chromosomal localization of the
human helix-loop-helix Id1 gene
JOURNAL Biochem. Biophys. Res. Commun. 231 (3), 628-634 (1997)
PUBMED 9070860
REFERENCE 7 (bases 1 to 1000)
AUTHORS Mathew,S., Chen,W., Murty,V.V., Benezra,R. and Chaganti,R.S.
TITLE Chromosomal assignment of human ID1 and ID2 genes
JOURNAL Genomics 30 (2), 385-387 (1995)
PUBMED 8586447
REFERENCE 8 (bases 1 to 1000)
AUTHORS Zhu,W., Dahmen,J., Bulfone,A., Rigolet,M., Hernandez,M.C.,
Kuo,W.L., Puelles,L., Rubenstein,J.L. and Israel,M.A.
TITLE Id gene expression during development and molecular cloning of the
human Id-1 gene
JOURNAL Brain Res. Mol. Brain Res. 30 (2), 312-326 (1995)
PUBMED 7637581
REFERENCE 9 (bases 1 to 1000)
AUTHORS Deed,R.W., Jasiok,M. and Norton,J.D.
TITLE Nucleotide sequence of the cDNA encoding human helix-loop-helix
Id-1 protein: identification of functionally conserved residues
common to Id proteins
JOURNAL Biochim. Biophys. Acta 1219 (1), 160-162 (1994)
PUBMED 8086456
REFERENCE 10 (bases 1 to 1000)
AUTHORS Hara,E., Yamaguchi,T., Nojima,H., Ide,T., Campisi,J., Okayama,H.
and Oda,K.
TITLE Id-related genes encoding helix-loop-helix proteins are required
for G1 progression and are repressed in senescent human fibroblasts
JOURNAL J. Biol. Chem. 269 (3), 2139-2145 (1994)
PUBMED 8294468
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DA839689.1, BC012420.1 and
AI304595.1.
This sequence is a reference standard in the RefSeqGene project.
On Jul 28, 2011 this sequence version replaced gi:31317298.
Summary: The protein encoded by this gene is a helix-loop-helix
(HLH) protein that can form heterodimers with members of the basic
HLH family of transcription factors. The encoded protein has no DNA
binding activity and therefore can inhibit the DNA binding and
transcriptional activation ability of basic HLH proteins with which
it interacts. This protein may play a role in cell growth,
senescence, and differentiation. Two transcript variants encoding
different isoforms have been found for this gene. [provided by
RefSeq, Jul 2008].
Transcript Variant: This variant (1) encodes the longer isoform (a,
also called ID-1H).
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BM459926.1, BC012420.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-548 DA839689.1 1-548
549-968 BC012420.1 530-949
969-1000 AI304595.1 1-32 c
FEATURES Location/Qualifiers
source 1..1000
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="20"
/map="20q11"
gene 1..1000
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/note="inhibitor of DNA binding 1, dominant negative
helix-loop-helix protein"
/db_xref="GeneID:3397"
/db_xref="HGNC:5360"
/db_xref="HPRD:08980"
/db_xref="MIM:600349"
exon 1..531
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/inference="alignment:Splign:1.39.8"
misc_feature 19..21
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/note="upstream in-frame stop codon"
variation 22
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="g"
/db_xref="dbSNP:111423898"
variation 24
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:187603623"
variation 25
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:6060263"
variation 27
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:193117704"
variation 38
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:370858440"
variation 48
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="g"
/replace="t"
/db_xref="dbSNP:377301131"
variation 61
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace=""
/replace="t"
/db_xref="dbSNP:150269842"
variation 73
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:11545370"
variation 74
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:116070319"
variation 75
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:376983060"
variation 79..82
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace=""
/replace="ttct"
/db_xref="dbSNP:200063888"
variation 84
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:112751622"
variation 91
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:368282089"
variation 93
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="g"
/replace="t"
/db_xref="dbSNP:145255888"
variation 96
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:377259445"
variation 101
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:369992276"
variation 104
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="t"
/db_xref="dbSNP:200604962"
CDS 106..573
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/note="isoform a is encoded by transcript variant 1;
inhibitor of differentiation 1; dJ857M17.1.2 (inhibitor of
DNA binding 1, dominant negative helix-loop-helix
protein); class B basic helix-loop-helix protein 24"
/codon_start=1
/product="DNA-binding protein inhibitor ID-1 isoform a"
/protein_id="NP_002156.2"
/db_xref="GI:31317299"
/db_xref="CCDS:CCDS13185.1"
/db_xref="GeneID:3397"
/db_xref="HGNC:5360"
/db_xref="HPRD:08980"
/db_xref="MIM:600349"
/translation="
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
"
misc_feature <307..432
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/note="Helix-loop-helix domain, found in specific DNA-
binding proteins that act as transcription factors; 60-100
amino acids long. A DNA-binding basic region is followed
by two alpha-helices separated by a variable loop region;
HLH forms homo- and heterodimers; Region: HLH; cd00083"
/db_xref="CDD:28964"
misc_feature order(307..312,319..324,328..333,379..381,388..390,
400..402,406..411,421..423,427..432)
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/note="dimerization interface [polypeptide binding]; other
site"
/db_xref="CDD:28964"
misc_feature 397..438
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P41134.3);
Region: Nuclear export signal (By similarity)"
variation 115
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="g"
/replace="t"
/db_xref="dbSNP:182605830"
variation 116
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:199929795"
variation 123..128
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace=""
/replace="cagcac"
/db_xref="dbSNP:201043264"
variation 124
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:200754503"
variation 125
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:201311175"
variation 126
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="g"
/db_xref="dbSNP:199513964"
variation 130
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:147601935"
variation 141
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="g"
/db_xref="dbSNP:11545368"
variation 146
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:200951697"
variation 153
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:6088729"
variation 157
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:376161427"
variation 160
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="c"
/db_xref="dbSNP:6087680"
variation 168
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:370797817"
variation 180
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="g"
/db_xref="dbSNP:373232427"
variation 185
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="g"
/replace="t"
/db_xref="dbSNP:377464239"
variation 195
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:6060264"
variation 201
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="g"
/replace="t"
/db_xref="dbSNP:371235410"
variation 222
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:118096050"
variation 228
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:202207220"
variation 238
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:376198900"
variation 292
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1802548"
variation 298
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="g"
/db_xref="dbSNP:374447523"
STS 306..385
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/standard_name="PMC156147P2"
/db_xref="UniSTS:271379"
variation 310
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:375324492"
variation 318
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:368193908"
variation 349
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:200871145"
variation 352
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:140145935"
variation 355
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:142440693"
variation 360
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:372327011"
variation 363
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:374420403"
variation 385
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="t"
/db_xref="dbSNP:368820173"
variation 414
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:372332883"
variation 415
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:368903182"
variation 438
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:146843692"
variation 440
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="c"
/db_xref="dbSNP:140742440"
variation 444
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:375719249"
variation 448
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="g"
/db_xref="dbSNP:145878183"
variation 453
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:15817"
variation 458
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:200577120"
variation 459
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="g"
/db_xref="dbSNP:11545371"
variation 489
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:371527047"
STS 495..640
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/standard_name="PMC22262P1"
/db_xref="UniSTS:272102"
variation 498
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:149142371"
variation 529
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:143214025"
exon 532..994
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/inference="alignment:Splign:1.39.8"
variation 534
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:370401552"
variation 544
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:200627717"
variation 565
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:372956084"
variation 579
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:200894288"
variation 623
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:374966633"
variation 630
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="g"
/db_xref="dbSNP:8116155"
variation 631
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="t"
/db_xref="dbSNP:115136221"
variation 633
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:375037749"
variation 645
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="g"
/db_xref="dbSNP:116636122"
variation 667
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:1049707"
variation 669
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:148925564"
variation 746
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="t"
/db_xref="dbSNP:184161698"
STS 854..964
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/standard_name="WI-9304"
/db_xref="UniSTS:64649"
variation 857
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:148173220"
variation 869
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="g"
/db_xref="dbSNP:187285825"
variation 873
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:45559231"
variation 915
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="c"
/db_xref="dbSNP:1049895"
variation 924
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="g"
/db_xref="dbSNP:2811"
polyA_site 941
/gene="ID1"
/gene_synonym="bHLHb24; ID"
variation 944..945
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace=""
/replace="a"
/db_xref="dbSNP:35381870"
variation 946
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="c"
/replace="t"
/db_xref="dbSNP:192105299"
polyA_signal 966..971
/gene="ID1"
/gene_synonym="bHLHb24; ID"
variation 985
/gene="ID1"
/gene_synonym="bHLHb24; ID"
/replace="a"
/replace="t"
/db_xref="dbSNP:3171378"
polyA_site 994
/gene="ID1"
/gene_synonym="bHLHb24; ID"
ORIGIN
actctcattccacgttcttaactgttccattttccgtatctgcttcgggcttccacctcatttttttcgctttgcccattctgtttcagccagtcgccaagaatcatgaaagtcgccagtggcagcaccgccaccgccgccgcgggccccagctgcgcgctgaaggccggcaagacagcgagcggtgcgggcgaggtggtgcgctgtctgtctgagcagagcgtggccatctcgcgctgcgccgggggcgccggggcgcgcctgcctgccctgctggacgagcagcaggtaaacgtgctgctctacgacatgaacggctgttactcacgcctcaaggagctggtgcccaccctgccccagaaccgcaaggtgagcaaggtggagattctccagcacgtcatcgactacatcagggaccttcagttggagctgaactcggaatccgaagttggaacccccgggggccgagggctgccggtccgggctccgctcagcaccctcaacggcgagatcagcgccctgacggccgaggcggcatgcgttcctgcggacgatcgcatcttgtgtcgctgaagcgcctcccccagggaccggcggaccccagccatccagggggcaagaggaattacgtgctctgtgggtctcccccaacgcgcctcgccggatctgagggagaacaagaccgatcggcggccactgcgcccttaactgcatccagcctggggctgaggctgaggcactggcgaggagagggcgctcctctctgcacacctactagtcaccagagactttagggggtgggattccactcgtgtgtttctattttttgaaaagcagacattttaaaaaatggtcacgtttggtgcttctcagatttctgaggaaattgctttgtattgtatattacaatgatcaccgactgaaaatattgttttacaatagttctgtggggctgtttttttgttattaaacaaataatttagatggtggtaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:3397 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
GeneID:3397 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:3397 -> Molecular function: GO:0046983 [protein dimerization activity] evidence: IEA
GeneID:3397 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: IEA
GeneID:3397 -> Biological process: GO:0001525 [angiogenesis] evidence: TAS
GeneID:3397 -> Biological process: GO:0001886 [endothelial cell morphogenesis] evidence: IEA
GeneID:3397 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
GeneID:3397 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:3397 -> Biological process: GO:0007179 [transforming growth factor beta receptor signaling pathway] evidence: TAS
GeneID:3397 -> Biological process: GO:0007507 [heart development] evidence: IEA
GeneID:3397 -> Biological process: GO:0010621 [negative regulation of transcription by transcription factor localization] evidence: TAS
GeneID:3397 -> Biological process: GO:0030509 [BMP signaling pathway] evidence: IEA
GeneID:3397 -> Biological process: GO:0031648 [protein destabilization] evidence: IEA
GeneID:3397 -> Biological process: GO:0032963 [collagen metabolic process] evidence: IEA
GeneID:3397 -> Biological process: GO:0043392 [negative regulation of DNA binding] evidence: IEA
GeneID:3397 -> Biological process: GO:0043408 [regulation of MAPK cascade] evidence: IEA
GeneID:3397 -> Biological process: GO:0043433 [negative regulation of sequence-specific DNA binding transcription factor activity] evidence: IDA
GeneID:3397 -> Biological process: GO:0043534 [blood vessel endothelial cell migration] evidence: TAS
GeneID:3397 -> Biological process: GO:0045668 [negative regulation of osteoblast differentiation] evidence: IEA
GeneID:3397 -> Biological process: GO:0045765 [regulation of angiogenesis] evidence: IEA
GeneID:3397 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: IDA
GeneID:3397 -> Biological process: GO:0046677 [response to antibiotic] evidence: IEA
GeneID:3397 -> Biological process: GO:0048514 [blood vessel morphogenesis] evidence: TAS
GeneID:3397 -> Biological process: GO:0060425 [lung morphogenesis] evidence: IEA
GeneID:3397 -> Biological process: GO:0060426 [lung vasculature development] evidence: IEA
GeneID:3397 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
GeneID:3397 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.