GGRNA Home | Help | Advanced search

2019-03-23 03:23:10, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_002139               2097 bp    mRNA    linear   PRI 31-MAY-2013
DEFINITION  Homo sapiens RNA binding motif protein, X-linked (RBMX), transcript
            variant 1, mRNA.
ACCESSION   NM_002139
VERSION     NM_002139.3  GI:258645145
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2097)
  AUTHORS   Matsunaga,S., Takata,H., Morimoto,A., Hayashihara,K., Higashi,T.,
            Akatsuchi,K., Mizusawa,E., Yamakawa,M., Ashida,M., Matsunaga,T.M.,
            Azuma,T., Uchiyama,S. and Fukui,K.
  TITLE     RBMX: a regulator for maintenance and centromeric protection of
            sister chromatid cohesion
  JOURNAL   Cell Rep 1 (4), 299-308 (2012)
   PUBMED   22832223
  REMARK    GeneRIF: RBMX is a cohesion regulator that maintains the proper
            cohesion of sister chromatids.
REFERENCE   2  (bases 1 to 2097)
  AUTHORS   Adamson,B., Smogorzewska,A., Sigoillot,F.D., King,R.W. and
            Elledge,S.J.
  TITLE     A genome-wide homologous recombination screen identifies the
            RNA-binding protein RBMX as a component of the DNA-damage response
  JOURNAL   Nat. Cell Biol. 14 (3), 318-328 (2012)
   PUBMED   22344029
  REMARK    GeneRIF: Data show that RBMX accumulated at DNA lesions through
            multiple domains in a poly(ADP-ribose) polymerase 1-dependent
            manner and promoted HR by facilitating proper BRCA2 expression.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2097)
  AUTHORS   Shin,K.H., Kim,R.H., Yu,B., Kang,M.K., Elashoff,D., Christensen,R.,
            Pucar,A. and Park,N.H.
  TITLE     Expression and mutation analysis of heterogeneous nuclear
            ribonucleoprotein G in human oral cancer
  JOURNAL   Oral Oncol. 47 (11), 1011-1016 (2011)
   PUBMED   21840245
  REMARK    GeneRIF: studied the genetic and expression states of hnRNP G in
            normal, premalignant and malignant human oral tissues to further
            understand the relationship between the hnRNP G alterations and the
            development of human oral cancer
REFERENCE   4  (bases 1 to 2097)
  AUTHORS   Heinrich,B., Zhang,Z., Raitskin,O., Hiller,M., Benderska,N.,
            Hartmann,A.M., Bracco,L., Elliott,D., Ben-Ari,S., Soreq,H.,
            Sperling,J., Sperling,R. and Stamm,S.
  TITLE     Heterogeneous nuclear ribonucleoprotein G regulates splice site
            selection by binding to CC(A/C)-rich regions in pre-mRNA
  JOURNAL   J. Biol. Chem. 284 (21), 14303-14315 (2009)
   PUBMED   19282290
REFERENCE   5  (bases 1 to 2097)
  AUTHORS   Shin,K.H., Kim,R.H., Kim,R.H., Kang,M.K. and Park,N.H.
  TITLE     hnRNP G elicits tumor-suppressive activity in part by upregulating
            the expression of Txnip
  JOURNAL   Biochem. Biophys. Res. Commun. 372 (4), 880-885 (2008)
   PUBMED   18541147
  REMARK    GeneRIF: These studies indicate that hnRNP G promotes the
            expression of Txnip and mediates its tumor-suppressive effect.
REFERENCE   6  (bases 1 to 2097)
  AUTHORS   Mazeyrat,S., Saut,N., Mattei,M.G. and Mitchell,M.J.
  TITLE     RBMY evolved on the Y chromosome from a ubiquitously transcribed
            X-Y identical gene
  JOURNAL   Nat. Genet. 22 (3), 224-226 (1999)
   PUBMED   10391207
REFERENCE   7  (bases 1 to 2097)
  AUTHORS   Delbridge,M.L., Lingenfelter,P.A., Disteche,C.M. and Graves,J.A.
  TITLE     The candidate spermatogenesis gene RBMY has a homologue on the
            human X chromosome
  JOURNAL   Nat. Genet. 22 (3), 223-224 (1999)
   PUBMED   10391206
REFERENCE   8  (bases 1 to 2097)
  AUTHORS   Venables,J.P., Vernet,C., Chew,S.L., Elliott,D.J., Cowmeadow,R.B.,
            Wu,J., Cooke,H.J., Artzt,K. and Eperon,I.C.
  TITLE     T-STAR/ETOILE: a novel relative of SAM68 that interacts with an
            RNA-binding protein implicated in spermatogenesis
  JOURNAL   Hum. Mol. Genet. 8 (6), 959-969 (1999)
   PUBMED   10332027
REFERENCE   9  (bases 1 to 2097)
  AUTHORS   Soulard,M., Della Valle,V., Siomi,M.C., Pinol-Roma,S., Codogno,P.,
            Bauvy,C., Bellini,M., Lacroix,J.C., Monod,G., Dreyfuss,G. et al.
  TITLE     hnRNP G: sequence and characterization of a glycosylated
            RNA-binding protein
  JOURNAL   Nucleic Acids Res. 21 (18), 4210-4217 (1993)
   PUBMED   7692398
REFERENCE   10 (bases 1 to 2097)
  AUTHORS   Le Coniat,M., Soulard,M., Della Valle,V., Larsen,C.J. and Berger,R.
  TITLE     Localization of the human gene encoding heterogeneous nuclear RNA
            ribonucleoprotein G (hnRNP-G) to chromosome 6p12
  JOURNAL   Hum. Genet. 88 (5), 593-595 (1992)
   PUBMED   1551662
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BM147410.1, DC337568.1,
            BC007435.2 and BM993214.1.
            On Sep 18, 2009 this sequence version replaced gi:56699408.
            
            Summary: This gene belongs to the RBMY gene family which includes
            candidate Y chromosome spermatogenesis genes. This gene, an active
            X chromosome homolog of the Y chromosome RBMY gene, is widely
            expressed whereas the RBMY gene evolved a male-specific function in
            spermatogenesis. Pseudogenes of this gene, found on chromosomes 1,
            4, 9, 11, and 6, were likely derived by retrotransposition from the
            original gene. Alternatively spliced transcript variants encoding
            different isoforms have been identified. A snoRNA gene (SNORD61) is
            found in one of its introns. [provided by RefSeq, Sep 2009].
            
            Transcript Variant: This variant (1) represents the more frequently
            occurring transcript and it encodes the longer protein (isoform 1).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC006550.2, BM480306.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025081, ERS025082 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-209               BM147410.1         1-209
            210-239             DC337568.1         155-184
            240-2067            BC007435.2         176-2003
            2068-2097           BM993214.1         1-30                c
FEATURES             Location/Qualifiers
     source          1..2097
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="X"
                     /map="Xq26.3"
     gene            1..2097
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /note="RNA binding motif protein, X-linked"
                     /db_xref="GeneID:27316"
                     /db_xref="HGNC:9910"
                     /db_xref="MIM:300199"
     exon            1..184
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    163..165
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /note="upstream in-frame stop codon"
     exon            185..319
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /inference="alignment:Splign:1.39.8"
     variation       210
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2011584"
     CDS             211..1386
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /note="isoform 1 is encoded by transcript variant 1; RNA
                     binding motif protein, X chromosome; heterogeneous nuclear
                     ribonucleoprotein G; hnRNP G; glycoprotein p43;
                     RNA-binding motif protein, X chromosome"
                     /codon_start=1
                     /product="RNA-binding motif protein, X chromosome isoform
                     1"
                     /protein_id="NP_002130.2"
                     /db_xref="GI:56699409"
                     /db_xref="CCDS:CCDS14661.1"
                     /db_xref="GeneID:27316"
                     /db_xref="HGNC:9910"
                     /db_xref="MIM:300199"
                     /translation="
MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
"
     misc_feature    211..213
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N-acetylmethionine, in Heterogeneous nuclear
                     ribonucleoprotein G, alternate; propagated from
                     UniProtKB/Swiss-Prot (P38159.3); acetylation site"
     misc_feature    214..216
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N-acetylvaline, in Heterogeneous nuclear
                     ribonucleoprotein G, N-terminally processed; propagated
                     from UniProtKB/Swiss-Prot (P38159.3); acetylation site"
     misc_feature    229..468
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /note="RNA recognition motif in heterogeneous nuclear
                     ribonucleoprotein G (hnRNP G), Y chromosome RNA
                     recognition motif 1 (hRBMY), testis-specific heterogeneous
                     nuclear ribonucleoprotein G-T (hnRNP G-T) and similar
                     proteins; Region: RRM_RBMX_like; cd12382"
                     /db_xref="CDD:240828"
     misc_feature    order(235..237,241..243,247..261,322..324,328..339,
                     343..363,367..369,442..444,448..450,454..468)
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240828"
     misc_feature    <235..>465
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /note="RNA-binding proteins (RRM domain) [General function
                     prediction only]; Region: COG0724"
                     /db_xref="CDD:223796"
     misc_feature    298..300
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N6-acetyllysine; propagated from
                     UniProtKB/Swiss-Prot (P38159.3); acetylation site"
     misc_feature    382..384
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    382..384
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    472..474
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (P38159.3); phosphorylation site"
     misc_feature    472..474
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    481..483
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    727..861
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /note="RBM1CTR (NUC064) family; Region: RBM1CTR;
                     pfam08081"
                     /db_xref="CDD:149260"
     misc_feature    733..735
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    763..765
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="methylation site"
     misc_feature    766..918
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P38159.3);
                     Region: Necessary for the association to nascent RNAPII
                     transcripts and nuclear localization"
     misc_feature    832..834
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    832..834
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    1195..1197
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (P38159.3); phosphorylation site"
     misc_feature    1204..1206
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (P38159.3); phosphorylation site"
     misc_feature    1207..1383
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P38159.3);
                     Region: Necessary for RNA-binding"
     misc_feature    1264..1266
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (P38159.3); phosphorylation site"
     misc_feature    1264..1266
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     exon            320..426
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /inference="alignment:Splign:1.39.8"
     exon            427..598
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /inference="alignment:Splign:1.39.8"
     exon            599..751
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /inference="alignment:Splign:1.39.8"
     variation       673
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11558422"
     exon            752..866
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /inference="alignment:Splign:1.39.8"
     variation       834
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1056264"
     exon            867..992
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /inference="alignment:Splign:1.39.8"
     variation       962
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11556431"
     exon            993..1075
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /inference="alignment:Splign:1.39.8"
     variation       1018
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374604645"
     exon            1076..2082
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /inference="alignment:Splign:1.39.8"
     variation       1215
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:16978599"
     variation       1220
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35899675"
     variation       1276
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:35085326"
     variation       1296
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34606958"
     variation       1479
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:15259"
     variation       1536
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2230685"
     STS             1666..2011
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /standard_name="DXS7491"
                     /db_xref="UniSTS:29985"
     variation       1691
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:850"
     variation       1859
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:849"
     variation       2017
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:10147"
     polyA_signal    2044..2049
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
     polyA_site      2067
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
     polyA_site      2082
                     /gene="RBMX"
                     /gene_synonym="hnRNP-G; HNRNPG; HNRPG; RBMXP1; RBMXRT;
                     RNMX"
ORIGIN      
ggtccttcagcctcgttcccgggcagtataaagtttgctgtctcctttgttcgccctcgttgcgcagtagtgctagcggcttcgcggttcggtcctcgcacccggcagccgccactggtgctgagctgctaggaagcccctatcgccgagctcgttggagcttgaacccattgtcacccctccgactcaccggcccaaaaaaaaaaaaacatggttgaagcagatcgcccaggaaagctcttcattggtgggcttaatacggaaacaaatgagaaagctcttgaagcagtatttggcaaatatggacgaatagtggaagtactcttgatgaaagaccgtgaaaccaacaaatcaagaggatttgcttttgtcacctttgaaagcccagcagacgctaaggatgcagccagagacatgaatggaaagtcattagatggaaaagccatcaaggtggaacaagccaccaaaccatcatttgaaagtggtagacgtggaccgcctccacctccaagaagtagaggccctccaagaggtcttagaggtggaagaggaggaagtggaggaaccaggggacctccctcacggggaggacacatggatgacggtggatattccatgaattttaacatgagttcttccaggggaccactcccagtaaaaagaggaccaccaccaagaagtgggggtcctcctcctaagagatctgcaccttcaggaccagttcgcagtagcagtggaatgggaggaagagctcctgtatcacgtggaagagatagttatggaggtccacctcgaagggaaccgctgccctctcgtagagatgtttatttgtccccaagagatgatgggtattctactaaagacagctattcaagcagagattacccaagttctcgtgatactagagattatgcaccaccaccacgagattatacttaccgtgattatggtcattccagttcacgtgatgactatccatcaagaggatatagcgatagagatggatatggtcgtgatcgtgactattcagatcatccaagtggaggttcctacagagattcatatgagagttatggtaactcacgtagtgctccacctacacgagggcccccgccatcttatggtggaagcagtcgctatgatgattacagcagctcacgtgacggatatggtggaagtcgagacagttactcaagcagccgaagtgatctctactcaagtggtcgtgatcgggttggcagacaagaaagagggcttcccccttctatggaaagggggtaccctcctccacgtgattcctacagcagttcaagccgcggagcaccaagaggtggtggccgtggaggaagccgatctgatagagggggaggcagaagcagatactagaaacaaacaaaactttggaccaaaatcccagttcaaagaaacaaaaagtggaaactattctatcataactacccaaggactactaaaaggaaaaattgtgttactttttttaaattccctgttaagttcccctccataatttttatgttcttgtgaggaaaaaagtaaaacatgtttaattttatttgactttcgcattgcttttcaacaagcaaatgttaaatgtgttaagacttgtactagtgttgtaactttccaagtaaaagtatcccctaaaggccacttcctatctgatttttcccagcaaatgaggcaggcaattctaagatcttccacaaaacatctagccatctaaaatggagagatgaatcattctacctatacaaacaagctagctattagagggtggttggggtatgctactcataagatttcagggtgtcttccaactgaaatctcaatgttctcagtacgaaaaacctgaaatcacatgcctatgtaaggaaagtgctattcacccagtaaacccaaaaaagcaaatggataatgctggccattttgcctttctgacatttccttgggaatctgcaagaacctcccctttcccttcccccaataagaccatttaagtgtgtgttaaacaactacagaatactaaataaaaagtttggccaaaaccaaccatgaagctgcaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:27316 -> Molecular function: GO:0000166 [nucleotide binding] evidence: IEA
            GeneID:27316 -> Molecular function: GO:0001047 [core promoter binding] evidence: IDA
            GeneID:27316 -> Molecular function: GO:0003682 [chromatin binding] evidence: IDA
            GeneID:27316 -> Molecular function: GO:0003723 [RNA binding] evidence: IDA
            GeneID:27316 -> Molecular function: GO:0003723 [RNA binding] evidence: NAS
            GeneID:27316 -> Molecular function: GO:0003729 [mRNA binding] evidence: IDA
            GeneID:27316 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:27316 -> Biological process: GO:0000381 [regulation of alternative mRNA splicing, via spliceosome] evidence: IDA
            GeneID:27316 -> Biological process: GO:0000398 [mRNA splicing, via spliceosome] evidence: IC
            GeneID:27316 -> Biological process: GO:0000398 [mRNA splicing, via spliceosome] evidence: TAS
            GeneID:27316 -> Biological process: GO:0006366 [transcription from RNA polymerase II promoter] evidence: IDA
            GeneID:27316 -> Biological process: GO:0006509 [membrane protein ectodomain proteolysis] evidence: IDA
            GeneID:27316 -> Biological process: GO:0008380 [RNA splicing] evidence: TAS
            GeneID:27316 -> Biological process: GO:0010467 [gene expression] evidence: TAS
            GeneID:27316 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IDA
            GeneID:27316 -> Biological process: GO:0048025 [negative regulation of mRNA splicing, via spliceosome] evidence: ISS
            GeneID:27316 -> Biological process: GO:0048026 [positive regulation of mRNA splicing, via spliceosome] evidence: ISS
            GeneID:27316 -> Biological process: GO:0051260 [protein homooligomerization] evidence: ISS
            GeneID:27316 -> Biological process: GO:0071347 [cellular response to interleukin-1] evidence: IDA
            GeneID:27316 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:27316 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
            GeneID:27316 -> Cellular component: GO:0005719 [nuclear euchromatin] evidence: IDA
            GeneID:27316 -> Cellular component: GO:0044530 [supraspliceosomal complex] evidence: IDA
            GeneID:27316 -> Cellular component: GO:0070062 [extracellular vesicular exosome] evidence: IDA
            GeneID:27316 -> Cellular component: GO:0071013 [catalytic step 2 spliceosome] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.